[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99112.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:448 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   125->189 1av1A PDBj 8e-04 20.0 %
:RPS:PDB   167->315 3d79A PDBj 2e-04 16.1 %
:RPS:PFM   147->258 PF09728 * Taxilin 7e-04 24.3 %
:HMM:PFM   117->221 PF12128 * DUF3584 0.00047 26.0 104/1202  
:BLT:SWISS 145->248 MUKB_ACTPJ 2e-04 33.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99112.1 GT:GENE ABD99112.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 325026..326372 GB:FROM 325026 GB:TO 326372 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99112.1 GB:DB_XREF GI:90820473 LENGTH 448 SQ:AASEQ MAVANNQYINFDLLRYQNEVLDITNKFKGRVGDTQDYIKLFVTSNSYPVDLRGMKLLFGGVDPNQVAHRHYLDFRADQKTDNLQHGHCTVYFDENTFNCDGIWKQAYFKFIDANGNTVSTVDMVLKVLDDTFYAAVGQTANIAVAEFKKLVEQATDKEKEAEQQMQSLSDNAKAKFQAAYDEYKQAIKEVYDEIFDEKKGLKVNYTRLQEIAQSIQETLRQAQFHDRPFQFDTVAIMKNYLELQDGDLAITSGWDSKDDGHGNMWQVRAKKRDETPDEINVIALQSGYVAERNLSMISADSLEDIMYGYSIKIVHNQKDYPKPTVFYYENAIGTEVGGLGAGSFGETLTKLVPCETEYTNNNSVVVRIPRNFYMNAKPYYKYGDWYLSSGNKTIKISLSNVDDSAAKAGDGKGSSYLSHSTGYFNYPTAPSDLRAVYVNDTAERLERK GT:EXON 1|1-448:0| BL:SWS:NREP 1 BL:SWS:REP 145->248|MUKB_ACTPJ|2e-04|33.0|103/1496| COIL:NAA 36 COIL:NSEG 1 COIL:REGION 140->175| RP:PDB:NREP 2 RP:PDB:REP 125->189|1av1A|8e-04|20.0|65/201| RP:PDB:REP 167->315|3d79A|2e-04|16.1|143/167| RP:PFM:NREP 1 RP:PFM:REP 147->258|PF09728|7e-04|24.3|107/294|Taxilin| HM:PFM:NREP 1 HM:PFM:REP 117->221|PF12128|0.00047|26.0|104/1202|DUF3584| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 42.2 SQ:SECSTR ############################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccTTHHEccHHHHHHHHHHHHHHHTHcHHHHHHHccTTccEEEHHEEEETTEEEEEETTEEEEEEETTEEEEcHHHHHHHTTTccGGGcT##TEEEEcGGGHHHHHEEEcTTccTTcEEEEEETTTccEEEEEEEcccHHHHHHccccEEEEEEE##################################################################################################################################### DISOP:02AL 1-4,152-173,404-413,444-449| PSIPRED cccccccEEEEEEEEEccHHHHHHHHccccccccccEEEEEEEcccccEEEccEEEEEccccHHHHHHHHHcccccccccccccccEEEEEEEcccccccHHHHHHEEEEEcccccEEHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccEEEEccccccccccccEEEEEEcccccccHHEEEEEEEccEEEcccccEEccHHHHHHHccEEEEEEEccccccccEEEEEEccccccccccccccHHHHHHHHcccccccccccEEEEEEccccEEccccccEEccEEEccccEEEEEEEccccccHHcccccccccEEcccccccccccccccEEEEEEccHHHHHHcc //