[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99116.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->81 PF10805 * DUF2730 9.2e-06 16.0 50/106  
:BLT:SWISS 31->85 HMW2_MYCPN 2e-04 38.2 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99116.1 GT:GENE ABD99116.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 327634..327939 GB:FROM 327634 GB:TO 327939 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99116.1 GB:DB_XREF GI:90820477 LENGTH 101 SQ:AASEQ MHSLLGYSWAEIASILAVISVLFSGVYWLIRHGAKVLNNAINIGTYPLQQQFKELTNTIKQLNGNFEEEHKNLKRLEHEVEQHDKAIILHEEKIKRLEERK GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 31->85|HMW2_MYCPN|2e-04|38.2|55/1818| COIL:NAA 52 COIL:NSEG 1 COIL:REGION 50->101| TM:NTM 1 TM:REGION 9->31| HM:PFM:NREP 1 HM:PFM:REP 32->81|PF10805|9.2e-06|16.0|50/106|DUF2730| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,96-102| PSIPRED ccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //