[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99117.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->67 PF04531 * Phage_holin_1 1.1e-07 32.7 55/84  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99117.1 GT:GENE ABD99117.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 327936..328262 GB:FROM 327936 GB:TO 328262 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99117.1 GB:DB_XREF GI:90820478 LENGTH 108 SQ:AASEQ MKKALFDKDGKLNRKVVTSLVLLLIVLVEQLCAIFGLKFTGDVGQIMNLVNTVLTIGGILGLVDGTTVDVDTVNTIEETANKALKIAKTSNDTPKSLAETIDKDGNVK GT:EXON 1|1-108:0| TM:NTM 2 TM:REGION 16->38| TM:REGION 42->64| SEG 16->28|vvtslvlllivlv| SEG 60->73|lglvdgttvdvdtv| HM:PFM:NREP 1 HM:PFM:REP 13->67|PF04531|1.1e-07|32.7|55/84|Phage_holin_1| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,90-91,103-109| PSIPRED cccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccc //