[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99134.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->52 PF10844 * DUF2577 7.5e-05 43.5 23/98  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99134.1 GT:GENE ABD99134.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(350599..350835) GB:FROM 350599 GB:TO 350835 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99134.1 GB:DB_XREF GI:90820495 LENGTH 78 SQ:AASEQ MSENVFFNPGQSISSSYDFDKAYTAAKIYHMKADNSVLIVQEKDGQPYVIFDEAKALQQEAAEGKKYSVIKRVSHDKE GT:EXON 1|1-78:0| HM:PFM:NREP 1 HM:PFM:REP 30->52|PF10844|7.5e-05|43.5|23/98|DUF2577| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,71-71,75-79| PSIPRED ccccEEEcccHHHHHcccHHHHHHHHHHHHHHHcccEEEEEEcccccEEHHHHHHHcccccccccEEEEEEEcccccc //