[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99139.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:367 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   126->325 PF07907 * YibE_F 4e-30 39.6 %
:HMM:PFM   125->360 PF07907 * YibE_F 3.5e-70 37.0 235/244  
:BLT:SWISS 150->199 UPPP_PSYCK 9e-05 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99139.1 GT:GENE ABD99139.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 355319..356422 GB:FROM 355319 GB:TO 356422 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG5438 [S] Predicted multitransmembrane protein GB:PROTEIN_ID ABD99139.1 GB:DB_XREF GI:90820500 LENGTH 367 SQ:AASEQ MMRVKKKYLIEWLLIILSGILIYFFVDNDSFLYKDPVAQIVSVTNSKATKTEDTYKNKDMTTEQTLKVKVLNGHRKGEVLTAKNTFSKSGGYDQRFYRGQKVFIKFEKSDGKLMAMINNYKRDVYLIMLCWAVVVLLFLVTQIRGFTSLISVILNFIIFLLCVQLDVKWNINNFFWIFATVAVIFLALSLVLVIGFNWQCLVTFSSIFIGTTLAMIIGVVAMQVTNDKGVHYEALDFATQSPKQLFLAATVIGLLGAVMDAATDIVSTLFEMKRTQPGISRKQLFISGQNVGKSIMGPLVNVLLLIFFAETVTMAVLFFRTGNSIAYTFEWTMSLGIIQSLISGIGITLVIPSASLLSSLVLGGDNK GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 150->199|UPPP_PSYCK|9e-05|40.0|50/280| TM:NTM 7 TM:REGION 8->29| TM:REGION 123->145| TM:REGION 147->169| TM:REGION 173->195| TM:REGION 202->224| TM:REGION 291->313| TM:REGION 337->359| SEG 334->349|slgiiqslisgigitl| SEG 353->362|sasllsslvl| RP:PFM:NREP 1 RP:PFM:REP 126->325|PF07907|4e-30|39.6|197/244|YibE_F| HM:PFM:NREP 1 HM:PFM:REP 125->360|PF07907|3.5e-70|37.0|235/244|YibE_F| OP:NHOMO 92 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1----------------------------------------------------1----------------------------------------------------------1---------------------------2-----------1111111111111111111112111111213111111111111111---------------------------------------------2212111111111---22111----------111-1---1------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----1----------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------2---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,365-368| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccccccEEEEEEEccccEEEEEEEcccccEEEEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccc //