[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99144.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:REPEAT 2|96->115|128->147
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99144.1 GT:GENE ABD99144.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 360871..361320 GB:FROM 360871 GB:TO 361320 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99144.1 GB:DB_XREF GI:90820505 LENGTH 149 SQ:AASEQ MITITNFIEHTFNGLTLDKVANFAKQLVLATMIRRNFFDNNQTVGGSIDVLTIASNGKVSWMQKGKNVRDIELKVTSEERTGHNLKKPRISDEPELTFDEWIEKQISLAEKVVNREEKQDDEDSKDEISFKEWINQQIKSAEEIVKRNE GT:EXON 1|1-149:0| NREPEAT 1 REPEAT 2|96->115|128->147| SEG 116->127|eekqddedskde| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 80-88,112-128,143-144,147-150| PSIPRED cEEHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccEEHHHccccEEEEEEEEEcHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //