[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99153.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.60.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->108 1r0uA PDBj 3e-08 30.1 %
:RPS:SCOP  1->143 1r0uA  b.60.1.5 * 8e-13 20.9 %
:HMM:SCOP  1->143 1r0uA_ b.60.1.5 * 1.5e-27 31.2 %
:RPS:PFM   18->141 PF09148 * DUF1934 8e-11 33.6 %
:HMM:PFM   10->141 PF09148 * DUF1934 3.2e-35 34.4 128/129  
:BLT:SWISS 3->108 YWIB_BACSU 8e-08 30.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99153.1 GT:GENE ABD99153.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 371538..371975 GB:FROM 371538 GB:TO 371975 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD99153.1 GB:DB_XREF GI:90820514 LENGTH 145 SQ:AASEQ MELKNGTPIVVKVETIRKQDGEVSKYTENFNGQYVKMGSNIYLRYQEKHDQHEDATVTFKITDDGEVQLNRQQGEMKMRLYFASQKRVSTTYKTPYGVIPIETLTNKINISKKDMPISAKVEVDYLLYSQEKIVGEYKIRLQFTA GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 3->108|YWIB_BACSU|8e-08|30.1|103/100| BL:PDB:NREP 1 BL:PDB:REP 3->108|1r0uA|3e-08|30.1|103/142| RP:PFM:NREP 1 RP:PFM:REP 18->141|PF09148|8e-11|33.6|119/128|DUF1934| HM:PFM:NREP 1 HM:PFM:REP 10->141|PF09148|3.2e-35|34.4|128/129|DUF1934| RP:SCP:NREP 1 RP:SCP:REP 1->143|1r0uA|8e-13|20.9|134/142|b.60.1.5| HM:SCP:REP 1->143|1r0uA_|1.5e-27|31.2|138/146|b.60.1.5|1/1|Lipocalins| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1----1-1-11-1---11111-11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 71.0 SQ:SECSTR ##cEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEE#EEE#TTEEEEEE#EEcccEEEEEETTcEEEEEEEETTEEEEEEEEEEEE##################################### DISOP:02AL 1-4,145-146| PSIPRED ccccccEEEEEEEEEEEEEcccEEEEEEEcccEEEEEccEEEEEEEEEccccccEEEEEEEccccEEEEEEEcccEEEEEEEEcccEEEEEEEcccEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEccEEEEEEEEEEEEEc //