[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99161.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   56->114 PF01080 * Presenilin 5e-04 39.6 %
:BLT:SWISS 22->197 Y562A_THEMA 5e-08 29.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99161.1 GT:GENE ABD99161.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 378509..379165 GB:FROM 378509 GB:TO 379165 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99161.1 GB:DB_XREF GI:90820522 LENGTH 218 SQ:AASEQ MKKFNWSFDIIMLIFIEISMLVSLVSSFIEHKSMLYIAETIAGILLALAPVIASSLFRFNLPKFLNAFYLLFIYGSVYLGTLLHFYSVPYWDKGLHLISGALLASFGFSLYGMIVPKHLREHMPAGFLVLYALSFAIFCGVCWEFYEFTCDGLFGMNLQRYASSAGKAFVGRAALMDTMGDLIADTIGAGLLCIYAYFNIKRSSRWLQGFYFHKSFRF GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 22->197|Y562A_THEMA|5e-08|29.5|156/100| TM:NTM 6 TM:REGION 6->28| TM:REGION 35->57| TM:REGION 66->88| TM:REGION 96->118| TM:REGION 123->145| TM:REGION 179->200| RP:PFM:NREP 1 RP:PFM:REP 56->114|PF01080|5e-04|39.6|53/373|Presenilin| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF01080|IPR001108| GO:PFM GO:0023034|"GO:intracellular signaling pathway"|PF01080|IPR001108| OP:NHOMO 45 OP:NHOMOORG 39 OP:PATTERN ---------------------------1---------------------1--1--------------- ---------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------1222222----------------------1---11---------1111-------------------------------------------------------11111111-1-1----111-1--------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,218-219| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccc //