[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99174.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  179/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.32
:278 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->270 1ztvB PDBj 2e-59 42.5 %
:RPS:SCOP  2->263 1vpyA  c.1.32.1 * 4e-66 42.1 %
:HMM:SCOP  1->263 1vpyA_ c.1.32.1 * 1.4e-66 36.4 %
:RPS:PFM   21->260 PF01904 * DUF72 8e-39 41.6 %
:HMM:PFM   22->259 PF01904 * DUF72 2.8e-59 37.9 219/230  
:BLT:SWISS 1->145 YECE_ECOLI 4e-07 27.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99174.1 GT:GENE ABD99174.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(393233..394069) GB:FROM 393233 GB:TO 394069 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD99174.1 GB:DB_XREF GI:90820535 LENGTH 278 SQ:AASEQ MITLGLTTWNEHPALIHNEDRRVTLSEYSAYFPTVELDTFFYGIPRIFTVENWQAQVPESFQFVVKANKVLTLHEQSDIQHINLTFHNFLESLQPLIDKNQLKTVLFQFPPYFTLNKKSTNYLRYLRQKLPNISISLEFRHKSWYNDTKKLVNFCRELGFTLVIADEPSRLDSSVPFLPVITNPDLTFFRLHGRNIEGWENPGKNWRAKRTLYRYSDDELLELKQVIQKLQSDTKEICIIFNNNSGKDAAPNALKLQEFLNITFDNLGPKPPEQLNFF GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|YECE_ECOLI|4e-07|27.9|136/272| BL:PDB:NREP 1 BL:PDB:REP 1->270|1ztvB|2e-59|42.5|268/275| RP:PFM:NREP 1 RP:PFM:REP 21->260|PF01904|8e-39|41.6|221/229|DUF72| HM:PFM:NREP 1 HM:PFM:REP 22->259|PF01904|2.8e-59|37.9|219/230|DUF72| RP:SCP:NREP 1 RP:SCP:REP 2->263|1vpyA|4e-66|42.1|242/251|c.1.32.1| HM:SCP:REP 1->263|1vpyA_|1.4e-66|36.4|261/0|c.1.32.1|1/1|TM1631-like| OP:NHOMO 212 OP:NHOMOORG 196 OP:PATTERN ----11--111-111121-1-----------------------------------------1221--- -12------------1---------1-------111----11----------111------------11-------------2211-1--------1--1-1---213-1-----------------------------------1---1----------------1--2-------------21111-1-111111111111111111111111111111111111111111111111111111111111111-1-11-1---111111111--------------------------------------------------1---------------------------1--------1----1--112---1-------------111-1-1------------------------------2----1---------------------------11----------------------------------------1---1---1-------1111--------1-------------1----------1--------------------1-----------212------1111-11-----------------------121--------------1111--------------------------------------------------------------------------------------------------------------------------------111--------1--1-------111------------1-------------------1-----11---------------------------------------------------------------11-111111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 96.4 SQ:SECSTR cEEEEEEcccccHHHHcc##ccccHHHHTTTccEEEEcHHHHccccHHHHHHHHHHcccccEEEEEccTTTTTcccGGGTcccHHHHHHHHHcHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHHTTTccEEEEcccTTTTHHHHHHHHHHHHTTcEEcEEEcccccccccccccccccTTEEEEEEcccccTTccTTcTTHHHHTTcccccHHHHHHHHHHHHHHHTTccEEEEEEcccccccHHHHHHHHHHHTTccccccccc######## PSIPRED cEEEEcccccccccccccccHHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHcccccEEEEEEEcHHcHHHHHccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEccHHHcccHHHHHHHHHHcccEEEEEccccccccccccccccccccEEEEEEccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHcccccccccccHHHcccc //