[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99178.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  224/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->289 2qv7A PDBj 3e-08 30.6 %
:RPS:PDB   5->289 2bonA PDBj 3e-35 21.8 %
:RPS:SCOP  4->289 2qv7A1  e.52.1.2 * 2e-38 24.1 %
:RPS:PFM   9->112 PF00781 * DAGK_cat 6e-11 40.6 %
:HMM:PFM   5->119 PF00781 * DAGK_cat 2.2e-26 36.5 104/129  
:HMM:PFM   139->289 PF00609 * DAGK_acc 6.1e-05 24.3 148/161  
:BLT:SWISS 6->239 YTLR_BACSU 1e-22 31.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99178.1 GT:GENE ABD99178.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(396466..397395) GB:FROM 396466 GB:TO 397395 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG1597 [IR] Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase GB:PROTEIN_ID ABD99178.1 GB:DB_XREF GI:90820539 LENGTH 309 SQ:AASEQ MIEKKYFFIINPIAGNGRGLAAWKKIRKTLQEQGISYTHKYTFPNQESNQEMILNTVDENHIIVVLGGDGTINEILNILIDCHLQNPLSYIACGSGNDFARAISLPSNPLKAWKYIHHQATIKKICVGKVKINDTERYFLNNVGIGFDARIVYSANHSKLKMLLNKIHLGALVYASFFLKALIIQKFFPTLFKNDGTSVQKYKKTFLCTITNHPFFGGGVKLVPEASVFNQSIDAIILEKSTKLGFLINFLRTILPLKNPSNSKNWHHQYGKEFKITINSHQPIHIDGEASIIDLDTVSFDTITFPFLA GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 6->239|YTLR_BACSU|1e-22|31.4|229/309| TM:NTM 1 TM:REGION 168->190| BL:PDB:NREP 1 BL:PDB:REP 59->289|2qv7A|3e-08|30.6|193/293| RP:PDB:NREP 1 RP:PDB:REP 5->289|2bonA|3e-35|21.8|252/287| RP:PFM:NREP 1 RP:PFM:REP 9->112|PF00781|6e-11|40.6|96/126|DAGK_cat| HM:PFM:NREP 2 HM:PFM:REP 5->119|PF00781|2.2e-26|36.5|104/129|DAGK_cat| HM:PFM:REP 139->289|PF00609|6.1e-05|24.3|148/161|DAGK_acc| GO:PFM:NREP 2 GO:PFM GO:0004143|"GO:diacylglycerol kinase activity"|PF00781|IPR001206| GO:PFM GO:0007205|"GO:activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway"|PF00781|IPR001206| RP:SCP:NREP 1 RP:SCP:REP 4->289|2qv7A1|2e-38|24.1|257/299|e.52.1.2| OP:NHOMO 342 OP:NHOMOORG 226 OP:PATTERN --------------------------------------------------------------1----- ----1-1-------------------------1-------------1-----1-1-----------1--11-------11--------1122-111-----1---11--1---------------111111-11-12221111131-11-111--11-----------111------------1-1------1222222222222222212222322222222223333332122222222222222212222223-33122122222223322212222222222111-----------11111111111112221112222-21-111111111112-------2---11----11----11--111-1---1---------------------------------1---1--1---12--------------1----------------------------------------------------------------------------------------------------------------------------------------1--------------------1----------------------------------------1-----------1----------------------------------------------------------------------------------------------------------------------1111---1-----------------------------------------------------------------1-11------------------11--------------1---------------------------1--1-111--- -----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 91.3 SQ:SECSTR ####cEEEEEccccTTcHH##HHHHHHHHHHTTTccEEEEEcccTTHTHHHHHHHHHHHHTcEEEEEcHHHHHHHHHHHcccccccEEEEEEcccccHHHHHTTccccHHHHHHHHHTHHHcEEEEEEEEEETTEccEEccEEEEEEEEEcccEccccccEEEEEEETcHHHHHHHHHTccEEEEEcEEEEEEETTEEEEEEEEEcEEEEEcccccTTTccccTTccTTcccEEEEEEccccccHHHEEET#HHHHHHTTcccTTEEEEEEcEEEEEEEEEEEEEETTE#################### DISOP:02AL 1-2| PSIPRED ccccEEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccccHHHHHHHHHccccEEEEEEEEEEEccccEEEEEEEcccHHHHHHHHccHHHcccccccccccHHHHHHHHHHHHHccccccEEEEEccEEEEEcccEEEEEEEccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEccccEEEEcccEEEcccccEEEEEEEEEccc //