[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99179.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.120.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->59 1sv7A PDBj 1e-04 37.0 %
:RPS:PDB   4->71 1do9A PDBj 1e-09 22.7 %
:RPS:SCOP  4->70 1j03A  d.120.1.2 * 2e-09 26.9 %
:HMM:SCOP  4->67 1t0gA_ d.120.1.2 * 6.4e-11 35.9 %
:HMM:PFM   5->57 PF00173 * Cyt-b5 1.9e-10 25.5 51/76  
:BLT:SWISS 1->54 PGRC2_HUMAN 2e-05 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99179.1 GT:GENE ABD99179.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 397556..397783 GB:FROM 397556 GB:TO 397783 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG4892 [R] Predicted heme/steroid binding protein GB:PROTEIN_ID ABD99179.1 GB:DB_XREF GI:90820540 LENGTH 75 SQ:AASEQ MAEKIFTLDELKNYDGKEGRKAYIAVDGVVYDVTNVAAWQGGTHHGNNAGNDVSDRIVKAPHGKSTLEKLEVVEN GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 1->54|PGRC2_HUMAN|2e-05|37.0|54/223| BL:PDB:NREP 1 BL:PDB:REP 6->59|1sv7A|1e-04|37.0|54/109| RP:PDB:NREP 1 RP:PDB:REP 4->71|1do9A|1e-09|22.7|66/94| HM:PFM:NREP 1 HM:PFM:REP 5->57|PF00173|1.9e-10|25.5|51/76|Cyt-b5| RP:SCP:NREP 1 RP:SCP:REP 4->70|1j03A|2e-09|26.9|67/102|d.120.1.2| HM:SCP:REP 4->67|1t0gA_|6.4e-11|35.9|64/109|d.120.1.2|1/1|Cytochrome b5-like heme/steroid binding domain| OP:NHOMO 40 OP:NHOMOORG 29 OP:PATTERN ----------------------------------1--------------1132--------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1-1---55--11------------------------------------------------------1111111111--1-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1-11------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 93.3 SQ:SECSTR #ccccccHHHHTTccccTTcEcEEEcccEEEEcGGGTTTcccccHHHTTTccTHHHHHHHTccHHHHHHHH#### DISOP:02AL 1-3,75-76| PSIPRED cccccccHHHHHHHccccccEEEEEEccEEEEcccccccccccccccccHHHHHHHHHHccccHHHHHccccccc //