[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99197.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->54 PF00365 * PFK 0.00059 28.6 42/282  
:BLT:SWISS 3->62 YKZS_BACSU 1e-05 25.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99197.1 GT:GENE ABD99197.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 426126..426320 GB:FROM 426126 GB:TO 426320 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99197.1 GB:DB_XREF GI:90820558 LENGTH 64 SQ:AASEQ MEKDYTALLDELREGTLDKLEINTEEFMDFQKAFMNYSHRKNIVGTAKRGGGATYIYSKESKLI GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 3->62|YKZS_BACSU|1e-05|25.0|60/100| HM:PFM:NREP 1 HM:PFM:REP 13->54|PF00365|0.00059|28.6|42/282|PFK| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-----1---11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,64-65| PSIPRED ccHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHHHccccccEEEEEEEccccEEEEEcHHHccc //