[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99202.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->135 2ax6A PDBj 5e-04 31.8 %
:RPS:PFM   17->324 PF03706 * UPF0104 9e-07 22.1 %
:HMM:PFM   17->325 PF03706 * UPF0104 1.8e-39 24.9 285/294  
:BLT:SWISS 11->328 Y2231_ARCFU 1e-16 27.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99202.1 GT:GENE ABD99202.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 430960..431979 GB:FROM 430960 GB:TO 431979 GB:DIRECTION + GB:PRODUCT Hypothetical secreted protein GB:NOTE COG0392 [S] Predicted integral membrane protein GB:PROTEIN_ID ABD99202.1 GB:DB_XREF GI:90820563 LENGTH 339 SQ:AASEQ MTRKNRIVLFIMFGIGIAIFLFSLREISFRSFVHDVTTLNLWWLGIAFLCMFLSLVFEALVIKILVQRQIKSYPFFDALRVPMLEQLFNGITPFSTGGQPAQLFALMQSGLDAGRATSSTLMKFIVYQAMIVVNFVLCLLIGFNFIQEKIHTLAWLVVFGFIIHLAVIVSLLMVMYWYDFTKKFIKVTLLPIKWIFNDEKYRNWNKIVDEKIDNFYEESLKLKSNWKLLLKISAITFVQLAVYYIIPYFILLSLGVTHVNVIMVISMHVLIVMVVSLFPIPGGAGGAEYSFSVIFSSFIGTGSKLVLAMLLWRIVTYYFGMLSGLIAMLIQPKRIVTKK GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 11->328|Y2231_ARCFU|1e-16|27.2|298/328| TM:NTM 8 TM:REGION 6->28| TM:REGION 46->68| TM:REGION 121->143| TM:REGION 150->172| TM:REGION 228->250| TM:REGION 261->283| TM:REGION 287->309| TM:REGION 311->332| SEG 219->233|slklksnwklllkis| BL:PDB:NREP 1 BL:PDB:REP 43->135|2ax6A|5e-04|31.8|88/242| RP:PFM:NREP 1 RP:PFM:REP 17->324|PF03706|9e-07|22.1|285/291|UPF0104| HM:PFM:NREP 1 HM:PFM:REP 17->325|PF03706|1.8e-39|24.9|285/294|UPF0104| OP:NHOMO 54 OP:NHOMOORG 49 OP:PATTERN -----------------------1--------------------12----1----------------- ------------------------------------------------------------------------------1-----------------1-------------------------------------------------------------------------------------------1--------------------1---------------111111-----------------------1111111111111111111111--------------------------------------------------1------------3------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1-1121211--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 26.0 SQ:SECSTR ##########################################HTTccHHHHHHHHHTcEEETTcc#####TTHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccc############################################################################################################################################################################################################ DISOP:02AL 1-2,337-340| PSIPRED cccccEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //