[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99207.1
DDBJ      :             Putative competence protein/transcription factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   165->280 3eb7C PDBj 1e-05 11.6 %
:RPS:PFM   1->160 PF06054 * CoiA 2e-32 45.0 %
:HMM:PFM   1->231 PF06054 * CoiA 3.4e-42 28.7 230/375  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99207.1 GT:GENE ABD99207.1 GT:PRODUCT Putative competence protein/transcription factor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 443698..444597 GB:FROM 443698 GB:TO 444597 GB:DIRECTION + GB:PRODUCT Putative competence protein/transcription factor GB:NOTE COG4469 [R] Competence protein GB:PROTEIN_ID ABD99207.1 GB:DB_XREF GI:90820568 LENGTH 299 SQ:AASEQ MIYAKDEKNNIVEANMAKKGRKYYCSGCHGQVILRCGKLRVSHFAHKKHACDIFSEGETLEHLRGKKLLMTWLRKEGKNPQIEAYLTSLHQRPDILCNNKAFEFQCSPISVERMSKRSKGYISEGYDFFWFLGKRHLIRKRLTQQIAQFIRWHKNLGFYLIYINVEQRNMEVYYHIQQADFLPVRFYRKKVNSWKELQDFFKQNRIKNYNLLSISERKRQKNCFYRNCLQSTNKFKKLQVICYTHGYILQEIYEEISSERYTYPIYKEYIFTKKMYEKLNLKDIELYYQLPFINFSNID GT:EXON 1|1-299:0| RP:PDB:NREP 1 RP:PDB:REP 165->280|3eb7C|1e-05|11.6|112/588| RP:PFM:NREP 1 RP:PFM:REP 1->160|PF06054|2e-32|45.0|160/257|CoiA| HM:PFM:NREP 1 HM:PFM:REP 1->231|PF06054|3.4e-42|28.7|230/375|CoiA| OP:NHOMO 121 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1111111111111111111111111111111--111111--111111111-1111--1111111-11111111111111111-111-11111-11111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 37.5 SQ:SECSTR ####################################################################################################################################################################HTccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHGGGGccTTcT##TTTHHHHHHHHHHHHHHH##HHHHHHHHHTccHHHHHHHHHHHHHHHH################### DISOP:02AL 299-300| PSIPRED cEEEEcccccEEEHHHccccccEEccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEcHHHccccHHHHHHHHHHHHHHccccEEEEEcccccEEEEcccccHHHcccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccEEEEEEEcccccccccc //