[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99219.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  134/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->225 PF01988 * VIT1 1e-31 37.0 %
:HMM:PFM   18->225 PF01988 * VIT1 1.1e-56 38.0 208/213  
:BLT:SWISS 5->230 PCL1_SCHPO 8e-26 33.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99219.1 GT:GENE ABD99219.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 454914..455606 GB:FROM 454914 GB:TO 455606 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0700 [S] Uncharacterized membrane protein GB:PROTEIN_ID ABD99219.1 GB:DB_XREF GI:90820580 LENGTH 230 SQ:AASEQ MDSTKQKSITLAQKINVLRAAVMGANDGIISVAGIVLGVAGAASSSFAILISGLAGMLAGTISMAMGEYVSVHSQSDAEVAAVVREKKILDTDYQKEFLFIKNKLLKAGISEELSHKATKEMMDRDPLKSIVREKYGFELNEKTNPYAAAIASMISFPLGATLPLLSILIFPVQYRIFGTMLAVIISLVFTGYFAAQLSHSSKLHGTIRNVISGMLTMIVTYFIGVMFSL GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 5->230|PCL1_SCHPO|8e-26|33.2|226/242| TM:NTM 4 TM:REGION 36->58| TM:REGION 149->171| TM:REGION 177->199| TM:REGION 207->229| SEG 28->49|giisvagivlgvagaasssfai| RP:PFM:NREP 1 RP:PFM:REP 18->225|PF01988|1e-31|37.0|208/211|VIT1| HM:PFM:NREP 1 HM:PFM:REP 18->225|PF01988|1.1e-56|38.0|208/213|VIT1| OP:NHOMO 180 OP:NHOMOORG 144 OP:PATTERN -----------------1-------------------------------------------------- ----111111---1111----1---2------1111-11-1-1----11---11------1111---1--1------------------------------1---11-------------------------------------2--------------------------------------------------------------------------------------------------------------2----2---2222--332224222111----111-111111-111-------------1--111------------------------------------------------------1---------------2---1-111----------1-----1--------------1----11----11-----1-22222222----1-----------------------------------111-1111--------------1--------1---1----------1--1-------11---------11---1-------------------1------1------------------------------------------1---------------------------------------------------------------------11-------------------------------------------------------------1---------------11111111-1-111-1-------1--------------1---------------1-----111------------------------------------------------------------1-- --------------1-----------------------------------------------------------------------11----------------------------------------------------------------------------------------21-----11---3-3-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8| PSIPRED ccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //