[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99220.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  132/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->227 PF01988 * VIT1 3e-26 29.7 %
:HMM:PFM   18->228 PF01988 * VIT1 2.5e-58 31.0 210/213  
:BLT:SWISS 5->229 PCL1_SCHPO 4e-26 35.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99220.1 GT:GENE ABD99220.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 455624..456313 GB:FROM 455624 GB:TO 456313 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0700 [S] Uncharacterized membrane protein GB:PROTEIN_ID ABD99220.1 GB:DB_XREF GI:90820581 LENGTH 229 SQ:AASEQ MLNKRKKKATMEEKMNVLRAGVLGSNDGILTVVGVLFSVGAATSNRFTILIAGLADLVACALSMSAGEYASVSVQRDTEKSAVEEEATNLKNNYSEQINIVKQYYQNKGVSLQTANLIAKQLMEKEDRVATLVNIKHGINMGQYLNPWMAAWSSMFSAALGGLFPLVAMTYAPSNSRWLATILAVIISVGLTGMISAKLGKSNIKYAVLRNIVVGIITMAIHYYVGQLI GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 5->229|PCL1_SCHPO|4e-26|35.7|224/242| TM:NTM 5 TM:REGION 17->39| TM:REGION 47->67| TM:REGION 151->172| TM:REGION 178->200| TM:REGION 207->229| SEG 148->159|wmaawssmfsaa| RP:PFM:NREP 1 RP:PFM:REP 18->227|PF01988|3e-26|29.7|209/211|VIT1| HM:PFM:NREP 1 HM:PFM:REP 18->228|PF01988|2.5e-58|31.0|210/213|VIT1| OP:NHOMO 181 OP:NHOMOORG 146 OP:PATTERN ----1-1----------1-------------------------------------------------- 1--1111111-1-11----------2------1----11-1------11---11---------1-1----1--------------1---------------1----1-------------------------------------1----------------------------------------------1---------------------------------------------------------------2----2---2222--332224222111----111-111111-111-------------1--111----------------------------------------------------------------------2--11-111----------1-------------------------11----11-------22222222----1-----------------------------------111-1111-------------11-------21---1----------1--1--1----11---------11---1-------------------1------1------------------------------11----------1---------------------------------------------------------------------11-----------------------------------------------------1111----1---------------1111111----111-1-------1--------------1---------------1-----111------------------------------------------------------------1-- --------------1-----------------------------------------------------------------------11----------------------------------------------------------------------------------------21-----21121--2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc //