[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99223.1
DDBJ      :             Transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->89 1u2wC PDBj 1e-07 40.0 %
:RPS:PDB   26->83 3bp8A PDBj 9e-10 8.9 %
:RPS:SCOP  22->105 1r1uA  a.4.5.5 * 2e-11 29.6 %
:HMM:SCOP  15->106 1u2wA1 a.4.5.5 * 1.9e-18 33.3 %
:RPS:PFM   14->83 PF05732 * RepL 2e-04 28.8 %
:HMM:PFM   30->77 PF01022 * HTH_5 2.3e-14 37.8 45/47  
:BLT:SWISS 14->89 Y1325_METJA 3e-09 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99223.1 GT:GENE ABD99223.1 GT:PRODUCT Transcriptional regulator, ArsR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 457759..458094 GB:FROM 457759 GB:TO 458094 GB:DIRECTION + GB:PRODUCT Transcriptional regulator, ArsR family GB:NOTE COG0583 [K] Transcriptional regulator GB:PROTEIN_ID ABD99223.1 GB:DB_XREF GI:90820584 LENGTH 111 SQ:AASEQ MSVSQLSKVQNEALDNFVENFDIINALADRNRQKIIVLLFGNLESGMTVTAITNNMSITQPAVSHHLKILRDSGIVAYRKDGLQSYYYLTLQEPLEKLENISRNLRLELEE GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 14->89|Y1325_METJA|3e-09|36.5|74/89| BL:PDB:NREP 1 BL:PDB:REP 23->89|1u2wC|1e-07|40.0|65/98| RP:PDB:NREP 1 RP:PDB:REP 26->83|3bp8A|9e-10|8.9|56/381| RP:PFM:NREP 1 RP:PFM:REP 14->83|PF05732|2e-04|28.8|66/140|RepL| HM:PFM:NREP 1 HM:PFM:REP 30->77|PF01022|2.3e-14|37.8|45/47|HTH_5| GO:PFM:NREP 2 GO:PFM GO:0006260|"GO:DNA replication"|PF05732|IPR008813| GO:PFM GO:0006276|"GO:plasmid maintenance"|PF05732|IPR008813| RP:SCP:NREP 1 RP:SCP:REP 22->105|1r1uA|2e-11|29.6|81/94|a.4.5.5| HM:SCP:REP 15->106|1u2wA1|1.9e-18|33.3|90/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 69 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22222142-212112------221----1-1-------1---------------1----1-1-22-----33--11121----1--------------------------------------------------1112111----1------1-1-------11----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 98.2 SQ:SECSTR ##HHHHHHHHHGGGGGGHHHHHHHHccHHHHHHHHHHHHHHcTTccccHHHHHHHccccHHHHHHHHHHHHHTTcEEEccccEEEEcccccccccHHHHEEcTTcccHHHH DISOP:02AL 1-4,6-6,8-8,110-112| PSIPRED ccHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHcc //