[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99227.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->95 PF06103 * DUF948 2e-11 49.3 %
:HMM:PFM   8->97 PF06103 * DUF948 3.8e-35 55.6 90/90  
:BLT:SWISS 35->112 Y1024_STAS1 3e-05 31.1 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99227.1 GT:GENE ABD99227.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 461276..461683 GB:FROM 461276 GB:TO 461683 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG4768 [R] Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain GB:PROTEIN_ID ABD99227.1 GB:DB_XREF GI:90820588 LENGTH 135 SQ:AASEQ MFLTFGQLAGLIAALAFLVLVIYLCRVLARLTSTVSELTKSIKTLTEDADDISEKIEDLLVKTNSLMDDVNQKSSKLDPLFQATSDLGESVSDLNQASRNFVENMGNSTHGLVKTSTMLKNGLRAIKLINKLRKK GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 35->112|Y1024_STAS1|3e-05|31.1|74/164| COIL:NAA 39 COIL:NSEG 1 COIL:REGION 31->69| TM:NTM 1 TM:REGION 7->29| SEG 5->22|fgqlagliaalaflvlvi| RP:PFM:NREP 1 RP:PFM:REP 23->95|PF06103|2e-11|49.3|73/90|DUF948| HM:PFM:NREP 1 HM:PFM:REP 8->97|PF06103|3.8e-35|55.6|90/90|DUF948| OP:NHOMO 71 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------111111----------------------11111111111111111111---1111111111-11111111111111111111111111111--11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 101-113,134-136| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //