[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99228.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->21 PF10855 * DUF2648 0.00029 57.9 19/33  
:HMM:PFM   15->119 PF07227 * DUF1423 0.00026 19.0 105/446  
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99228.1 GT:GENE ABD99228.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 461706..462155 GB:FROM 461706 GB:TO 462155 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99228.1 GB:DB_XREF GI:90820589 LENGTH 149 SQ:AASEQ MGKKLLIGLGVAGVAFYASKKLSGKYLEKAASKLDDIVAEGQETALKYREYLLDYLDEDDKLEKLNKKVLQAKDLVDKDSVTEALSNLKSSTSNLKDKLMEKEDSLDNDEDLQDDIVIDQRSAFGKMKEKTELENPAVVFYPDGTSETK GT:EXON 1|1-149:0| COIL:NAA 22 COIL:NSEG 1 COIL:REGION 83->104| TM:NTM 1 TM:REGION 5->19| SEG 46->65|lkyreylldyldeddklekl| SEG 85->99|lsnlksstsnlkdkl| SEG 103->120|edsldndedlqddividq| HM:PFM:NREP 2 HM:PFM:REP 3->21|PF10855|0.00029|57.9|19/33|DUF2648| HM:PFM:REP 15->119|PF07227|0.00026|19.0|105/446|DUF1423| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,90-105,145-150| PSIPRED cccEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccc //