[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99232.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y422_LACS1   RecName: Full=UPF0082 protein LSL_0422;

Homologs  Archaea  0/68 : Bacteria  881/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
e.39.1
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->242 1konA PDBj 5e-52 48.2 %
:RPS:SCOP  3->242 1konA  e.39.1.1 * 1e-87 46.9 %
:HMM:SCOP  5->241 1lfpA_ e.39.1.1 * 4e-93 53.4 %
:RPS:PFM   5->237 PF01709 * DUF28 1e-62 60.2 %
:HMM:PFM   5->237 PF01709 * DUF28 1.8e-101 54.5 231/234  
:BLT:SWISS 1->242 Y422_LACS1 e-139 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99232.1 GT:GENE ABD99232.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 465226..465954 GB:FROM 465226 GB:TO 465954 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD99232.1 GB:DB_XREF GI:90820593 LENGTH 242 SQ:AASEQ MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMVAKSGGPDPDGNPQLRLIMDKARAANMPKDNIKRAIDKATGTGGADYEEITYEGYGPAGVAILVHALTDNRNRTASAVRADFNRNGGNLGETGSVSFMFDRKGYIAIAREDLEVDEDQMFEDVIEAGGEDLQTSDEVFEIYTDPKAFADVRDELQKKYDLATAELTMVPQNTVPVPADKVEQLQRLIDRLEDEDDVSEVYTSADFPED GT:EXON 1|1-242:0| SW:ID Y422_LACS1 SW:DE RecName: Full=UPF0082 protein LSL_0422; SW:GN OrderedLocusNames=LSL_0422; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->242|Y422_LACS1|e-139|100.0|242/242| BL:PDB:NREP 1 BL:PDB:REP 3->242|1konA|5e-52|48.2|226/233| RP:PFM:NREP 1 RP:PFM:REP 5->237|PF01709|1e-62|60.2|231/234|DUF28| HM:PFM:NREP 1 HM:PFM:REP 5->237|PF01709|1.8e-101|54.5|231/234|DUF28| RP:SCP:NREP 1 RP:SCP:REP 3->242|1konA|1e-87|46.9|226/233|e.39.1.1| HM:SCP:REP 5->241|1lfpA_|4e-93|53.4|232/243|e.39.1.1|1/1|YebC-like| OP:NHOMO 1168 OP:NHOMOORG 1038 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-1111--111121111111111111111111111111111111111111111111111111111111111111111111-1-----1----1111111111111111111111111111221211111121112222221111111111111111111111211111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111121112222121111111111111111111111111111111111111111111111111212111111111111111111111111111111111111121212222222222222222222--11111--1---11111112222222222-2222222222222222222111111112122222222222222122112221-111111111111--12111111111121211111111111111111111111111221111222222222222211111111111112111111111111111111111111111111111111111111111----1-11111111111-11111111111111111121 ------1-------1111111111111111111111-11111111111111-1111-11111111111111-11111-1111111111--2111-11111---111-111112111--1111111211-131-11211-111111-1--111-11--12---1111-111-11222111111111-1111141221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 99.2 SQ:SECSTR ##ccccGGGTcccTTTTTccHHHHHHHHHHHHHHHHHcHcccGcccTTTHHHHHHHHHTTccHHHHHHHHccHHcccccccEEEEEEEEETTTEEEEEEEEEccHHHHHHHHHHHHHTTTcEEccTTccGGGEEEEEEEEEcccHTGccHHHHHHHHHHHTccEEEEcTTcEEEEEEGGGHHHHHHHHHHTccccEEEEEEEEcccccccTTTcHHHHHHHHHHHHcccEEEEEEcccccHH DISOP:02AL 1-1,4-4,242-243| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHccccHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEccccccccHHHHHHHHHHccccEEEEcccEEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEccccEEccHHHHHHHHHHHHHHHccccHHHEEcccccccc //