[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99236.1
DDBJ      :             ComG operon protein 3
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  8->82 1oqwA_ d.24.1.1 * 1.3e-14 28.0 %
:HMM:PFM   6->24 PF07963 * N_methyl 3.4e-08 63.2 19/20  
:HMM:PFM   16->94 PF07009 * DUF1312 0.00034 21.5 65/113  
:PROS 6->26|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99236.1 GT:GENE ABD99236.1 GT:PRODUCT ComG operon protein 3 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 469097..469399 GB:FROM 469097 GB:TO 469399 GB:DIRECTION + GB:PRODUCT ComG operon protein 3 GB:PROTEIN_ID ABD99236.1 GB:DB_XREF GI:90820597 LENGTH 100 SQ:AASEQ MKKKRRGFTLIEMAIVLFIISLLILIILPNIGTQRKHANTVNDKALQTQLNTQAELYMDEKNTNTVTIDELKSANYLNNDQYDQIKKKNIEIKLDNGKKE GT:EXON 1|1-100:0| PROS 6->26|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 9->31| SEG 15->31|ivlfiislliliilpni| HM:PFM:NREP 2 HM:PFM:REP 6->24|PF07963|3.4e-08|63.2|19/20|N_methyl| HM:PFM:REP 16->94|PF07009|0.00034|21.5|65/113|DUF1312| HM:SCP:REP 8->82|1oqwA_|1.3e-14|28.0|75/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----11--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,93-93,96-101| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccEEEEEEcccccEEEHHHHHccccccHHHHHHHHHccEEEEEcccccc //