[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99237.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->16 PF07963 * N_methyl 0.00018 57.1 14/20  
:HMM:PFM   47->76 PF03409 * Glycoprotein 0.001 23.3 30/358  
:BLT:SWISS 36->105 Y2F4_ENCCU 9e-04 30.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99237.1 GT:GENE ABD99237.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 469401..469823 GB:FROM 469401 GB:TO 469823 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99237.1 GB:DB_XREF GI:90820598 LENGTH 140 SQ:AASEQ MVGYTLLEMIIVLGIFMVLILLAYRPIKITWQNYEERQFIKNFERKWNQSTIKSIQEEKHTNVYFYHDLVRFSEYNKDRTTNDYEFSYPSTMHGDTNIVKISDNGSVTPKTIKIFSSLGRRYVFVFQMGYGAKYYVKTYQ GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 36->105|Y2F4_ENCCU|9e-04|30.8|65/616| TM:NTM 1 TM:REGION 4->26| HM:PFM:NREP 2 HM:PFM:REP 3->16|PF07963|0.00018|57.1|14/20|N_methyl| HM:PFM:REP 47->76|PF03409|0.001|23.3|30/358|Glycoprotein| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcHHHHHHHHHHccccEEEEHHHHHHHHccccccccccEEcccccccccccEEEEcccccccHHHHHHHHHcccEEEEEEEEccccEEEEEEEc //