[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99240.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->84 PF03834 * Rad10 0.00066 37.8 37/69  
:HMM:PFM   13->32 PF12177 * Proho_convert 0.00047 47.1 17/41  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99240.1 GT:GENE ABD99240.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 470228..470488 GB:FROM 470228 GB:TO 470488 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99240.1 GB:DB_XREF GI:90820601 LENGTH 86 SQ:AASEQ MDFKYVRVDNENNELILYSDAMDDFYELDLYKQQIRMRRKIDGYMPLLYNVQKVEWRYDENRKSIFISIRIHGREYSEEYIMDRKK GT:EXON 1|1-86:0| HM:PFM:NREP 2 HM:PFM:REP 46->84|PF03834|0.00066|37.8|37/69|Rad10| HM:PFM:REP 13->32|PF12177|0.00047|47.1|17/41|Proho_convert| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,85-87| PSIPRED ccEEEEEEEccccEEEEEEHHcccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEcccccEEEEEEEEccEEccHHHHHHccc //