[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99241.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->50 PF06923 * GutM 0.0001 20.6 34/109  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99241.1 GT:GENE ABD99241.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 470485..470766 GB:FROM 470485 GB:TO 470766 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99241.1 GB:DB_XREF GI:90820602 LENGTH 93 SQ:AASEQ MKSSFRKEGYLIYTSIYFLMFFLMIFLGQTLLFKWQILAYSREVNYYRARVMYEVVKRKNCDSENFNYGKVMWDKERRKYIIILKNGREYQFK GT:EXON 1|1-93:0| TM:NTM 1 TM:REGION 16->38| SEG 18->27|flmfflmifl| HM:PFM:NREP 1 HM:PFM:REP 17->50|PF06923|0.0001|20.6|34/109|GutM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,89-94| PSIPRED cccccccccEEEHHHHHHHHHHHHHHHccHHEEEEEEEEEEEccHHHHHHHHHHHHHHcccccccccEEEEEEEcccEEEEEEEEcccEEEcc //