[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99245.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  130/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->122 2kl5A PDBj 5e-26 50.5 %
:RPS:PFM   35->119 PF06265 * DUF1027 4e-26 58.8 %
:HMM:PFM   35->120 PF06265 * DUF1027 4.7e-41 59.3 86/86  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99245.1 GT:GENE ABD99245.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 475676..476260 GB:FROM 475676 GB:TO 476260 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99245.1 GB:DB_XREF GI:90820606 LENGTH 194 SQ:AASEQ MNSERKERREVQLAKKAETIEAAASEVLVINETRIKIDGRPYDLVENYHEGFSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILHNLEVQTPEPIPANIRKKSSKRKSQSSSKKHNSKNNVFTNEKRYNIRSQKNKKNAHLKSVSKKNTKHRHFTIRQK GT:EXON 1|1-194:0| SEG 136->155|kksskrksqssskkhnsknn| BL:PDB:NREP 1 BL:PDB:REP 32->122|2kl5A|5e-26|50.5|91/110| RP:PFM:NREP 1 RP:PFM:REP 35->119|PF06265|4e-26|58.8|85/86|DUF1027| HM:PFM:NREP 1 HM:PFM:REP 35->120|PF06265|4.7e-41|59.3|86/86|DUF1027| OP:NHOMO 130 OP:NHOMOORG 130 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 53.6 SQ:SECSTR ###############################ccEEEETTEEEEEEEEETTcccHHHHHHHccGGGGGTcEEEEEcTTcccEEEEccccccTTcccTTccTTHHHHHHHcccccccEEEEEEcTTTEEccccHHHH########################################################### DISOP:02AL 1-17,124-187,194-195| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEccEEEEEEEEHHHHccHHHHHHHHHHHHHHHcEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEcc //