[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99247.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->185 PF07314 * DUF1461 4e-09 32.5 %
:HMM:PFM   13->185 PF07314 * DUF1461 2e-45 32.9 173/181  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99247.1 GT:GENE ABD99247.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 477044..477688 GB:FROM 477044 GB:TO 477688 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0344 [S] Predicted membrane protein GB:PROTEIN_ID ABD99247.1 GB:DB_XREF GI:90820608 LENGTH 214 SQ:AASEQ MIRSIWIERVILLLFGVILFFFVLSLAISITINSDWLYYIFIKLEHLDKKVFLTSNELWHEYKTILYYLNFPWIETLHTKLPLSVSAIHHFEDVKKLFEFNYIVLLITSIMIGIMWRRIFTKTEWWNLLNLFKVSNIIILMLVCIVCLDFSNVFIVFHQLLFNNRDWIFNPANTPIIKALPELFFETCFIEIVVIFELVMYTFNWFLKNRLRRE GT:EXON 1|1-214:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 97->116| TM:REGION 137->159| TM:REGION 177->199| SEG 10->26|villlfgvilfffvlsl| SEG 137->148|iiilmlvcivcl| RP:PFM:NREP 1 RP:PFM:REP 27->185|PF07314|4e-09|32.5|154/187|DUF1461| HM:PFM:NREP 1 HM:PFM:REP 13->185|PF07314|2e-45|32.9|173/181|DUF1461| OP:NHOMO 70 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111------11------------------------------------111-11--111111111111------2111------1111111111111111111111111--111----------------1-1--------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,213-215| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //