[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99250.1
DDBJ      :             Polyribonucleotide nucleotidyltransferase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  455/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->78 2k4kA PDBj 2e-20 50.6 %
:RPS:PDB   1->78 3bzkA PDBj 9e-18 29.5 %
:RPS:SCOP  3->75 1sroA  b.40.4.5 * 1e-19 34.7 %
:HMM:SCOP  3->88 1go3E1 b.40.4.5 * 5.5e-22 31.8 %
:RPS:PFM   4->73 PF00575 * S1 9e-12 40.0 %
:HMM:PFM   3->75 PF00575 * S1 1.4e-22 35.6 73/74  
:HMM:PFM   110->133 PF07765 * KIP1 4.5e-05 45.8 24/74  
:BLT:SWISS 2->78 GS13_BACSU 5e-20 50.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99250.1 GT:GENE ABD99250.1 GT:PRODUCT Polyribonucleotide nucleotidyltransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 479626..480036 GB:FROM 479626 GB:TO 480036 GB:DIRECTION + GB:PRODUCT Polyribonucleotide nucleotidyltransferase GB:NOTE COG1098 [J] Predicted RNA binding protein (contains ribosomal protein S1 domain) GB:PROTEIN_ID ABD99250.1 GB:DB_XREF GI:90820611 LENGTH 136 SQ:AASEQ MRYRIGMIIEGRITGIQPYGAFVSLDNRTQGLIHISECHHGYVDNIRNFLKVGQMVRVMIIDIDEYTGKISLSIRCLEKAFDFSREKRRPGFNHRKYWTNKHVQEGFKPISKRMSKWINEALEDIEKKKKKLLTRY GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 2->78|GS13_BACSU|5e-20|50.6|77/130| SEG 127->133|kkkkkll| BL:PDB:NREP 1 BL:PDB:REP 2->78|2k4kA|2e-20|50.6|77/130| RP:PDB:NREP 1 RP:PDB:REP 1->78|3bzkA|9e-18|29.5|78/728| RP:PFM:NREP 1 RP:PFM:REP 4->73|PF00575|9e-12|40.0|70/74|S1| HM:PFM:NREP 2 HM:PFM:REP 3->75|PF00575|1.4e-22|35.6|73/74|S1| HM:PFM:REP 110->133|PF07765|4.5e-05|45.8|24/74|KIP1| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 1 RP:SCP:REP 3->75|1sroA|1e-19|34.7|72/76|b.40.4.5| HM:SCP:REP 3->88|1go3E1|5.5e-22|31.8|85/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 668 OP:NHOMOORG 473 OP:PATTERN -----------------------------------11------------------------------- 1111111----1-111111-111111111111111111--111211-11---111111--111--11211-1111111-12-----------11------------1-1---------------------------43344---1-2222222221111111122112221211111112111-1111--112322222222222222222223322222232224444441-311222222222121234322121111-21233112222212111122222221222222222222222222222222222112222222113-2-------1-12-221----21-1-1--111-1114--21111-----1------------------1--1--------------------------------------------------1--------------1---1---------11--1-111-1-1---------------------------------------111------1211121111----1---------------------1-----------111---211--1-1-1--------------------------11111-1-----1-----1-1------11-----1-111--1111111-1-11111111111-11111111-1111111111---11-111111111111111111111111111-1111111111111-2-11111-----1111-------1111-111------122--1----------------------------11-11111--111------------------11111111111111--1--------------------------11-1-----111 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------2---11-1115344-1211----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 91.2 SQ:SECSTR GGccTTcEEEEEEEEEETTEEEEEccccccEEEEGGGGcccccccHHHHccTTcEEEEEEEEEETTTTEEEEEccTTcGHEEcccEEEEccGGGHHHHHcGGHHHHTccHHHHHHHHTHHHHHH############ DISOP:02AL 1-1,78-116| PSIPRED cccccccEEEEEEEEEEccEEEEEEccccEEEEEEEEccccccccHHHEEccccEEEEEEEEEEccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //