[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99258.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.230.5
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->94 1y2iA_ d.230.5.1 * 5.1e-05 16.3 %
:HMM:PFM   36->89 PF01906 * DUF74 3e-06 24.0 50/105  
:BLT:SWISS 3->88 Y5168_BACLD 6e-04 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99258.1 GT:GENE ABD99258.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(497989..498273) GB:FROM 497989 GB:TO 498273 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99258.1 GB:DB_XREF GI:90820619 LENGTH 94 SQ:AASEQ MFLSTSGLNQSYILKGIVNATVKRTLKAEELDEVDQFDNLYAQVQKKLENKALELDADGVIDIRFVPQIVRVSVGPKYMLLHGYGTAISFPKKN GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 3->88|Y5168_BACLD|6e-04|29.6|81/100| HM:PFM:NREP 1 HM:PFM:REP 36->89|PF01906|3e-06|24.0|50/105|DUF74| HM:SCP:REP 1->94|1y2iA_|5.1e-05|16.3|92/0|d.230.5.1|1/1|YbjQ-like| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 7-7,93-95| PSIPRED cEEEEccccccEEEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEEcccEEEEEEEEEEEEEEcccc //