[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99260.1
DDBJ      :             Transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->132 1jgsA PDBj 2e-04 26.3 %
:RPS:PDB   34->144 3bpxB PDBj 1e-11 17.1 %
:RPS:SCOP  10->143 2ethA1  a.4.5.28 * 2e-15 21.6 %
:HMM:SCOP  1->140 1jgsA_ a.4.5.28 * 1.3e-26 22.6 %
:HMM:PFM   35->92 PF01047 * MarR 1.8e-12 31.0 58/59  
:HMM:PFM   64->142 PF01131 * Topoisom_bac 8.8e-05 23.6 72/404  
:BLT:SWISS 34->132 MARR_ECOLI 5e-04 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99260.1 GT:GENE ABD99260.1 GT:PRODUCT Transcriptional regulator, MarR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 499199..499639 GB:FROM 499199 GB:TO 499639 GB:DIRECTION + GB:PRODUCT Transcriptional regulator, MarR family GB:NOTE COG1522 [K] Transcriptional regulators GB:PROTEIN_ID ABD99260.1 GB:DB_XREF GI:90820621 LENGTH 146 SQ:AASEQ MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTATIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLEDFLKEHS GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 34->132|MARR_ECOLI|5e-04|26.3|99/144| SEG 83->96|rirgnddrriirig| BL:PDB:NREP 1 BL:PDB:REP 34->132|1jgsA|2e-04|26.3|99/138| RP:PDB:NREP 1 RP:PDB:REP 34->144|3bpxB|1e-11|17.1|111/138| HM:PFM:NREP 2 HM:PFM:REP 35->92|PF01047|1.8e-12|31.0|58/59|MarR| HM:PFM:REP 64->142|PF01131|8.8e-05|23.6|72/404|Topoisom_bac| RP:SCP:NREP 1 RP:SCP:REP 10->143|2ethA1|2e-15|21.6|134/140|a.4.5.28| HM:SCP:REP 1->140|1jgsA_|1.3e-26|22.6|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 85 OP:NHOMOORG 85 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1-----1111-1-111-1111111111111111111111111111111111111111111111---111111111111--11111111----11--------11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 99.3 SQ:SECSTR HHHHTTcHHHHHHHHHHHHHHHHHHHTGGGHHHTccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 1-1,144-147| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHcccccEEHEEcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHc //