[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99276.1
DDBJ      :             CBS domain containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->143 2emqA PDBj 2e-26 44.1 %
:RPS:PDB   2->138 3ctuB PDBj 8e-13 29.8 %
:RPS:SCOP  15->136 1yavA3  d.37.1.1 * 4e-16 37.7 %
:HMM:SCOP  15->72 1yavA1 d.37.1.1 * 0.00015 20.7 %
:HMM:SCOP  74->142 1yavA2 d.37.1.1 * 3e-15 40.6 %
:RPS:PFM   88->136 PF00571 * CBS 2e-04 40.8 %
:HMM:PFM   31->69 PF00571 * CBS 0.001 23.1 39/57  
:HMM:PFM   86->138 PF00571 * CBS 5.3e-16 41.5 53/57  
:HMM:PFM   52->93 PF08683 * CAMSAP_CKK 0.00031 28.6 42/124  
:BLT:SWISS 1->139 YKUL_BACSU 1e-20 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99276.1 GT:GENE ABD99276.1 GT:PRODUCT CBS domain containing protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 516557..517021 GB:FROM 516557 GB:TO 517021 GB:DIRECTION + GB:PRODUCT CBS domain containing protein GB:NOTE COG0517 [R] FOG: CBS domain GB:PROTEIN_ID ABD99276.1 GB:DB_XREF GI:90820637 LENGTH 154 SQ:AASEQ MMSQPIEQMLMRNSEDFLIPADIVANVQEENHLDHAFMVLTKVRYAKIPVLDHNQKFKGLLSLSMITEEMLGLKGIDARCLSKKQVKDVMQTEVETIKPTADCEEILHRLVNQPFLVVVDDDNRFLGIVTRRELLKSMNYLSHEFDNFYVTEPK GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 1->139|YKUL_BACSU|1e-20|36.7|139/147| BL:PDB:NREP 1 BL:PDB:REP 17->143|2emqA|2e-26|44.1|127/135| RP:PDB:NREP 1 RP:PDB:REP 2->138|3ctuB|8e-13|29.8|131/146| RP:PFM:NREP 1 RP:PFM:REP 88->136|PF00571|2e-04|40.8|49/56|CBS| HM:PFM:NREP 3 HM:PFM:REP 31->69|PF00571|0.001|23.1|39/57|CBS| HM:PFM:REP 86->138|PF00571|5.3e-16|41.5|53/57|CBS| HM:PFM:REP 52->93|PF08683|0.00031|28.6|42/124|CAMSAP_CKK| RP:SCP:NREP 1 RP:SCP:REP 15->136|1yavA3|4e-16|37.7|122/132|d.37.1.1| HM:SCP:REP 15->72|1yavA1|0.00015|20.7|58/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 74->142|1yavA2|3e-15|40.6|69/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 104 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111--1111111---------------------1111111-1-111111111----11111111111111111111111111111111111111111111111--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 96.8 SQ:SECSTR cHHHHHHHHHHTTHHHHEEEGGGccccEETTccHHHHHHHHTTccccEEEEcTTccEEEEEcHHHHHHHHHHHHHHTccHHHHTccGGGcccccccccTTccHHHHHHHHHHccEEEEEcTTccEEEEEEHHHHHHHHHHHHHHEccGG##### DISOP:02AL 1-2,148-152,154-155| PSIPRED ccHHHHHHHHHHHHHHEEEEccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHcccccccHHccccEEHHEEccccEEEcccccHHHHHHHHHHcccEEEEEccccEEEEEEHHHHHHHHHHHHcccccccEEccc //