[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99277.1
DDBJ      :             Tetrahydrodipicolinate N-acetyltransferase
Swiss-Prot:DAPH_LACS1   RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase;         EC=2.3.1.89;AltName: Full=Tetrahydrodipicolinate N-acetyltransferase;         Short=THP acetyltransferase;         Short=Tetrahydropicolinate acetylase;

Homologs  Archaea  7/68 : Bacteria  556/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->222 3cj8A PDBj 2e-54 59.7 %
:RPS:PDB   5->218 3cj8A PDBj 5e-22 48.1 %
:RPS:SCOP  86->234 1kgqA  b.81.1.2 * 4e-35 34.5 %
:HMM:SCOP  40->230 1tdtA_ b.81.1.2 * 1.4e-51 37.9 %
:RPS:PFM   4->84 PF08503 * DapD_N 1e-16 48.8 %
:HMM:PFM   4->84 PF08503 * DapD_N 7.6e-34 48.8 80/83  
:HMM:PFM   102->116 PF00132 * Hexapep 0.00029 60.0 15/18  
:HMM:PFM   119->136 PF00132 * Hexapep 0.0009 38.9 18/18  
:HMM:PFM   138->153 PF00132 * Hexapep 8.7e-05 43.8 16/18  
:HMM:PFM   164->178 PF00132 * Hexapep 0.00069 46.7 15/18  
:BLT:SWISS 1->234 DAPH_LACS1 e-120 100.0 %
:PROS 172->200|PS00101|HEXAPEP_TRANSFERASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99277.1 GT:GENE ABD99277.1 GT:PRODUCT Tetrahydrodipicolinate N-acetyltransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 517047..517751 GB:FROM 517047 GB:TO 517751 GB:DIRECTION + GB:PRODUCT Tetrahydrodipicolinate N-acetyltransferase GB:NOTE COG2171 [E] Tetrahydrodipicolinate N-succinyltransferase GB:PROTEIN_ID ABD99277.1 GB:DB_XREF GI:90820638 LENGTH 234 SQ:AASEQ MAKLDAHDIIRTIAESKKKTPVKVYVKGDLNSLDVPSNVETYFTDNVGVMFGDWADVEPILKDSSVESYHLENDGRNTGVAMVDKKKFNARIEPGAIIRDQVEIGDNAVVMMGAVINIGAEIGEGSMIDMGAVLGGRAIVGKNCHIGAGTVLAGVVEPPSAQPVVIEDDVLIGANAVVLEGVRVGKGAVVGAGAVVTKDVEPYTVVMGMPAKKVKDVSQVDDSKTEIVDDLRKL GT:EXON 1|1-234:0| SW:ID DAPH_LACS1 SW:DE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC=2.3.1.89;AltName: Full=Tetrahydrodipicolinate N-acetyltransferase; Short=THP acetyltransferase; Short=Tetrahydropicolinate acetylase; SW:GN Name=dapH; OrderedLocusNames=LSL_0468; SW:KW Acyltransferase; Amino-acid biosynthesis; Complete proteome;Diaminopimelate biosynthesis; Lysine biosynthesis; Repeat;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->234|DAPH_LACS1|e-120|100.0|234/234| GO:SWS:NREP 5 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 172->200|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| SEG 181->196|gvrvgkgavvgagavv| BL:PDB:NREP 1 BL:PDB:REP 5->222|3cj8A|2e-54|59.7|211/214| RP:PDB:NREP 1 RP:PDB:REP 5->218|3cj8A|5e-22|48.1|210/214| RP:PFM:NREP 1 RP:PFM:REP 4->84|PF08503|1e-16|48.8|80/83|DapD_N| HM:PFM:NREP 5 HM:PFM:REP 4->84|PF08503|7.6e-34|48.8|80/83|DapD_N| HM:PFM:REP 102->116|PF00132|0.00029|60.0|15/18|Hexapep| HM:PFM:REP 119->136|PF00132|0.0009|38.9|18/18|Hexapep| HM:PFM:REP 138->153|PF00132|8.7e-05|43.8|16/18|Hexapep| HM:PFM:REP 164->178|PF00132|0.00069|46.7|15/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 86->234|1kgqA|4e-35|34.5|148/274|b.81.1.2| HM:SCP:REP 40->230|1tdtA_|1.4e-51|37.9|190/0|b.81.1.2|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 583 OP:NHOMOORG 566 OP:PATTERN ------------------------1--11111---------------------1-------------- 11111-----------------------------------1-11--------------------------1-------1--11--1111-------1-111111111221---------------11111111111-------------------------------------------------------111111111111111111111121111111-111111111111111111111111111111111--11-1-1-111111-11111111-------11111111111111-------------1211111111-1-111111111111-2111111--------------------111-1-11--1111111111111111-1111111111111111-2212211211111111111111111111111111111-1111111111111111111-11111--1111-111111111111111111111111111111121111111111111111111111111111-1111-11111111111111111111111112-----------------1--1-11111--------------------------2--111111--21-2-1111111111111111111--1111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111-1--1111-11111-11111111111111-------------------1----1---2----------1---111111111111111111------------------------------------------1211111111--- --------------------------------------------------1----------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 98.7 SQ:SECSTR ###THHHHHHHHHHHcccccEEEEEEEEcTTcccccTTcEEEEcccEEEEEEEHHHHHHHHTTTTEEEEEEEEccccccccccccTTcccEEcTTcEEccccEEcTTcEETcEEcTTcEEcTTcEcTcEEccEEcTTcEEcTTcEEcTTcEEccccccTTccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcccccTTEEEETTTTEEEEEcccHHHHHHHHHHHHcGG DISOP:02AL 1-4,216-227| PSIPRED cccccHHHHHHHHHHHHccccEEEEEccccccEEEccccEEEccccEEEEEEcHHHEEHHEEccccccEEEEcccccccccHHHHcccccEEccccEEcccEEEccccEEEcccEEccccEEccccEEccccEEcccEEEccccEEcccEEEccccccccccccEEccccEEccccEEEccEEEcccEEEEcccEEEEEcccccEEEEcccEEEEEccHHHHHHHHHHHHHHcc //