[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99280.1
DDBJ      :             Transcription regulator, Crp family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->137 2gauA PDBj 5e-08 28.9 %
:BLT:PDB   120->211 3e6bA PDBj 5e-04 24.2 %
:RPS:PDB   11->214 3e5qB PDBj 5e-15 12.8 %
:RPS:SCOP  11->126 1cx4A2  b.82.3.2 * 4e-09 17.2 %
:RPS:SCOP  145->215 2fnaA1  a.4.5.11 * 6e-04 7.5 %
:HMM:SCOP  12->139 1omiA1 b.82.3.3 * 1.6e-14 25.8 %
:HMM:SCOP  146->212 1hw5A1 a.4.5.4 * 4.2e-07 22.4 %
:RPS:PFM   28->122 PF00027 * cNMP_binding 9e-04 30.6 %
:HMM:PFM   26->109 PF00027 * cNMP_binding 1.9e-06 23.8 84/91  
:HMM:PFM   171->206 PF08279 * HTH_11 9.1e-06 25.0 36/55  
:BLT:SWISS 23->210 ARCR_STAES 8e-09 22.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99280.1 GT:GENE ABD99280.1 GT:PRODUCT Transcription regulator, Crp family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 520190..520855 GB:FROM 520190 GB:TO 520855 GB:DIRECTION + GB:PRODUCT Transcription regulator, Crp family GB:NOTE COG0583 [K] Transcriptional regulator GB:PROTEIN_ID ABD99280.1 GB:DB_XREF GI:90820641 LENGTH 221 SQ:AASEQ MRSIIKKEFTLSNEEQEILVRACRIKKFKYAETIYNEVDDRTHYYYLLNGNIEITKLYGDREVPFYKGRGRFFPNFSQNEDLCCERVTVASKIATVLVIKHDVMEKLVRAGKEFCNLVWDDIIEELDFLKSLSQEIGNRNKLEALDRTYRLYAIFIDEKDKHGHYELPRSLNQEKLSKILGTTRVTVNKKIKELRQKRVLLQKERNMRIANKAIEEFKNFL GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 23->210|ARCR_STAES|8e-09|22.4|183/228| BL:PDB:NREP 2 BL:PDB:REP 11->137|2gauA|5e-08|28.9|114/218| BL:PDB:REP 120->211|3e6bA|5e-04|24.2|91/208| RP:PDB:NREP 1 RP:PDB:REP 11->214|3e5qB|5e-15|12.8|195/201| RP:PFM:NREP 1 RP:PFM:REP 28->122|PF00027|9e-04|30.6|85/90|cNMP_binding| HM:PFM:NREP 2 HM:PFM:REP 26->109|PF00027|1.9e-06|23.8|84/91|cNMP_binding| HM:PFM:REP 171->206|PF08279|9.1e-06|25.0|36/55|HTH_11| RP:SCP:NREP 2 RP:SCP:REP 11->126|1cx4A2|4e-09|17.2|116/139|b.82.3.2| RP:SCP:REP 145->215|2fnaA1|6e-04|7.5|67/73|a.4.5.11| HM:SCP:REP 12->139|1omiA1|1.6e-14|25.8|128/0|b.82.3.3|1/1|cAMP-binding domain-like| HM:SCP:REP 146->212|1hw5A1|4.2e-07|22.4|67/71|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1---------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 99.1 SQ:SECSTR #HHHHHHHHHcccGGGGGGGGGcEEEEEccccEEEccccccccEEEEEEEEEEEEEEcccccccEEEEEcTTcEEEcccccccEEEEEEEEEEEEEEEEcHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHTTTcEEETTEEEEcccccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEccTTcEEEccHHHHHHHHH# DISOP:02AL 1-4| PSIPRED cHHHHHHHccccHHHHHHHHcccEEEEcccccEEEccccccEEEEEEEEcEEEEEEEccccEEEEEEcccccccccccccccccEEEEEEEEEEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccEEEEccHHHHHHHHHc //