[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99282.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y473_LACS1   RecName: Full=UPF0342 protein LSL_0473;

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.281.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->109 2iazB PDBj 3e-07 36.8 %
:RPS:SCOP  3->108 2iazA1  a.281.1.2 * 2e-15 21.4 %
:RPS:PFM   4->109 PF06133 * DUF964 6e-04 34.0 %
:HMM:PFM   3->108 PF06133 * DUF964 9.6e-29 38.7 106/108  
:BLT:SWISS 1->114 Y473_LACS1 7e-50 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99282.1 GT:GENE ABD99282.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 523125..523469 GB:FROM 523125 GB:TO 523469 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD99282.1 GB:DB_XREF GI:90820643 LENGTH 114 SQ:AASEQ MINVYDTANQLEKDLRESQEYKDLQAVVAKVKADDATFAVYKKLREAQKTLQEQQMQGTLDEKVMKSLQEISQEASQYPLMMELMEKERAISVLIDDLNKIIFKPLSEVYDIEG GT:EXON 1|1-114:0| SW:ID Y473_LACS1 SW:DE RecName: Full=UPF0342 protein LSL_0473; SW:GN OrderedLocusNames=LSL_0473; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->114|Y473_LACS1|7e-50|100.0|114/114| SEG 22->36|kdlqavvakvkadda| BL:PDB:NREP 1 BL:PDB:REP 3->109|2iazB|3e-07|36.8|106/110| RP:PFM:NREP 1 RP:PFM:REP 4->109|PF06133|6e-04|34.0|106/109|DUF964| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF06133|9.6e-29|38.7|106/108|DUF964| RP:SCP:NREP 1 RP:SCP:REP 3->108|2iazA1|2e-15|21.4|103/107|a.281.1.2| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-111111--111111-----111111111--111111111111111-111111-1--1-1111111---11-------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 93.0 SQ:SECSTR ##HHHHHHHHHHHHHHTcHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHTTcccccHH#HHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHH##### DISOP:02AL 51-67,113-115| PSIPRED cccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //