[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99285.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->87 PF06103 * DUF948 2.9e-05 16.4 55/90  
:BLT:SWISS 38->92 RBP1_PLAF7 6e-04 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99285.1 GT:GENE ABD99285.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(525592..525870) GB:FROM 525592 GB:TO 525870 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99285.1 GB:DB_XREF GI:90820646 LENGTH 92 SQ:AASEQ MKKRKLIIPIALGAVGLAYYNRKALKNEFLIYKDYYENLSKELSQVSFASKKVLFNVMQLLDQVSESSDTIENLLTEIDTFSQEVNKTLDSF GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 38->92|RBP1_PLAF7|6e-04|34.5|55/100| HM:PFM:NREP 1 HM:PFM:REP 33->87|PF06103|2.9e-05|16.4|55/90|DUF948| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,89-93| PSIPRED ccccEEEEEHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //