[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99289.1
DDBJ      :             Phosphotransferase enzyme family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   155->219 2z7lA PDBj 6e-04 35.9 %
:RPS:PDB   3->255 3dxqB PDBj 7e-15 15.9 %
:RPS:SCOP  155->232 1nd4A  d.144.1.6 * 8e-10 21.1 %
:HMM:SCOP  9->232 1nd4A_ d.144.1.6 * 6.1e-23 23.3 %
:RPS:PFM   156->197 PF01633 * Choline_kinase 9e-05 42.9 %
:HMM:PFM   14->225 PF01636 * APH 2.8e-24 19.6 209/238  
:BLT:SWISS 72->194 LICA2_HAEIN 3e-05 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99289.1 GT:GENE ABD99289.1 GT:PRODUCT Phosphotransferase enzyme family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 528412..529200 GB:FROM 528412 GB:TO 529200 GB:DIRECTION + GB:PRODUCT Phosphotransferase enzyme family GB:NOTE COG0510 [M] Predicted choline kinase involved in LPS biosynthesis GB:PROTEIN_ID ABD99289.1 GB:DB_XREF GI:90820650 LENGTH 262 SQ:AASEQ MNLNLENGWQILPIGGDTDTAYMGIKSDQKVFLKRNTSPFLAALSLEEIAPRLIWTKRISTGDTLTAQEWLNGRSLYRSEMGQKSVSDLLYKVHHTPVLKKMLIQVGGKVVTPIDLVRKYFEGLPDDLNQHPLLNKVANYLKANQPDLKSDFYEVCHGDLNHKNWLLSDKEKLYLVDWESARIADPASDLSMLMCQYVPRKNWEQWLRQYGLEVNRDLWYRIYWYSLINLLLDVKYYHQRGRFTEMNQDILKISELINELNF GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 72->194|LICA2_HAEIN|3e-05|34.0|106/339| BL:PDB:NREP 1 BL:PDB:REP 155->219|2z7lA|6e-04|35.9|64/329| RP:PDB:NREP 1 RP:PDB:REP 3->255|3dxqB|7e-15|15.9|239/280| RP:PFM:NREP 1 RP:PFM:REP 156->197|PF01633|9e-05|42.9|42/202|Choline_kinase| HM:PFM:NREP 1 HM:PFM:REP 14->225|PF01636|2.8e-24|19.6|209/238|APH| RP:SCP:NREP 1 RP:SCP:REP 155->232|1nd4A|8e-10|21.1|76/255|d.144.1.6| HM:SCP:REP 9->232|1nd4A_|6.1e-23|23.3|215/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 115 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111-111111111--111111111111111111111-1-11-----11--1111----11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 97.7 SQ:SECSTR ##cGGTTccccEEEcccccEEEEETTEEEEEccHHHHHHHHHHHHHTTccccEEEccEEEcTTTccEEEccTTcEEcHHHHHHHHHHHHHHHHHTcccccccccccHHHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHHTcccccEEccccEEcccccGGGEEEcEccccEEcccTTcEEEcHHHHHHHHHHTTccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHcHHHHHHHTTcccccHHHHHHHHH#### DISOP:02AL 1-1| PSIPRED cccccccccEEEEcccccccEEEEEEccEEEEEEEcccHHHHHHHHcccccEEEEEEEcccccEEEEEEEEccEEccHHHHcHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccEEEEEcccccccEEEccccEEEEEEEcccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //