[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99300.1
DDBJ      :             Putative regulatory protein
Swiss-Prot:NRDR_LACS1   RecName: Full=Transcriptional repressor nrdR;

Homologs  Archaea  4/68 : Bacteria  738/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.98.1g.41.3
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->43 1i3qI2  g.41.3.1 * 2e-07 21.4 %
:RPS:SCOP  49->152 1r1rA1  a.98.1.1 * 4e-14 20.4 %
:RPS:PFM   49->137 PF03477 * ATP-cone 2e-10 38.2 %
:HMM:PFM   50->136 PF03477 * ATP-cone 4.5e-22 29.9 87/89  
:HMM:PFM   2->85 PF03367 * zf-ZPR1 2.7e-05 32.1 78/161  
:BLT:SWISS 1->157 NRDR_LACS1 8e-89 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99300.1 GT:GENE ABD99300.1 GT:PRODUCT Putative regulatory protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 540683..541156 GB:FROM 540683 GB:TO 541156 GB:DIRECTION + GB:PRODUCT Putative regulatory protein GB:NOTE COG1327 [K] Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains GB:PROTEIN_ID ABD99300.1 GB:DB_XREF GI:90820661 LENGTH 157 SQ:AASEQ MKCPNCHKNGSRVVDSRPADNGHAIRRRRECEQCGYRFTTFERVEVTPLLVIKKNGTREEFQREKLLRGIVRAAEKRPVGIDEITEIVDKVENKLRSVGGTEVSSQLIGEYVMKILADVDEVAYIRYASVYREFKDMHAFADELRELMDREENNSKD GT:EXON 1|1-157:0| SW:ID NRDR_LACS1 SW:DE RecName: Full=Transcriptional repressor nrdR; SW:GN Name=nrdR; OrderedLocusNames=LSL_0491; SW:KW ATP-binding; Complete proteome; DNA-binding; Metal-binding;Nucleotide-binding; Repressor; Transcription;Transcription regulation; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|NRDR_LACS1|8e-89|100.0|157/157| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| RP:PFM:NREP 1 RP:PFM:REP 49->137|PF03477|2e-10|38.2|89/89|ATP-cone| HM:PFM:NREP 2 HM:PFM:REP 50->136|PF03477|4.5e-22|29.9|87/89|ATP-cone| HM:PFM:REP 2->85|PF03367|2.7e-05|32.1|78/161|zf-ZPR1| RP:SCP:NREP 2 RP:SCP:REP 2->43|1i3qI2|2e-07|21.4|42/73|g.41.3.1| RP:SCP:REP 49->152|1r1rA1|4e-14|20.4|98/218|a.98.1.1| OP:NHOMO 744 OP:NHOMOORG 742 OP:PATTERN ---------------------------1-111------------------------------------ 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111--111----------------------111111111111111-----------1111111111111111111111111111111---11111111111111111111-1111111111111111111111-11111111111111111111111111111111111111111111111111111111111---111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111-1-1111-11--1111111111-11111111111111111111111-11111111111-1111111-111111111111111111111111111111113111111111111-------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111----------1111111111111111--------------------------11111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111-1111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111---------111111111111111111111111111111-----------------1---------------------------11111-1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 145-158| PSIPRED cccccccccccEEEEEEEcccccccHHHHccccccccccccEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccc //