[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99309.1
DDBJ      :             GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  154/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
a.24.25c.37.1
:373 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->373 3ec1A PDBj 2e-97 55.3 %
:RPS:PDB   27->193 1d6aA PDBj 9e-11 9.8 %
:RPS:PDB   171->231 2dwqB PDBj 8e-08 21.3 %
:RPS:SCOP  74->167 2p67A1  c.37.1.10 * 5e-04 22.0 %
:RPS:SCOP  154->246 1xzpA1  a.24.25.1 * 9e-09 13.3 %
:HMM:SCOP  68->288 1t9hA2 c.37.1.8 * 3.7e-32 30.7 %
:RPS:PFM   143->227 PF03193 * DUF258 4e-07 44.3 %
:HMM:PFM   180->237 PF01926 * MMR_HSR1 3.1e-11 39.6 53/108  
:HMM:PFM   106->163 PF00025 * Arf 0.00032 30.4 56/175  
:HMM:PFM   154->192 PF01637 * Arch_ATPase 0.00017 21.1 38/234  
:BLT:SWISS 7->373 YQEH_BACSU e-124 57.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99309.1 GT:GENE ABD99309.1 GT:PRODUCT GTP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 549316..550437 GB:FROM 549316 GB:TO 550437 GB:DIRECTION + GB:PRODUCT GTP-binding protein GB:NOTE COG1160 [R] Predicted GTPases GB:PROTEIN_ID ABD99309.1 GB:DB_XREF GI:90820670 LENGTH 373 SQ:AASEQ MTETSNEILYCIGCGAKIQSENPNELGYTPESAVKKGLETEELYCQRCFRLRHYNEIADVSLTDDDFLRLLNQIGESDSLIVNVVDIFDFNGSVIPGLHRFVGKNDVLLVGNKSDLLPKSLKRSRIKDWLRQEANKQGLRPIDVALTSASKGYEIDNLLELIDKYRKGRDVYVVGVTNVGKSTLINRIIKQQTGISELITTSRFPGTTLDKIEIPFDDGKNLIDTPGIIHKQQMAHYLTGKSLKFASPQKEIKPKVYQLNEGQTIFLGSLARFDYISGGRTSVIAYFDNNLPLHRTKLQNADKFYEKHAGELLQPPTREELKKMPKLTRFEFKVSEKSDLVFSGLGWISLSPNTIVAGWAPEGVGVLIRKAMI GT:EXON 1|1-373:0| BL:SWS:NREP 1 BL:SWS:REP 7->373|YQEH_BACSU|e-124|57.9|363/366| BL:PDB:NREP 1 BL:PDB:REP 65->373|3ec1A|2e-97|55.3|309/311| RP:PDB:NREP 2 RP:PDB:REP 27->193|1d6aA|9e-11|9.8|164/262| RP:PDB:REP 171->231|2dwqB|8e-08|21.3|61/337| RP:PFM:NREP 1 RP:PFM:REP 143->227|PF03193|4e-07|44.3|79/160|DUF258| HM:PFM:NREP 3 HM:PFM:REP 180->237|PF01926|3.1e-11|39.6|53/108|MMR_HSR1| HM:PFM:REP 106->163|PF00025|0.00032|30.4|56/175|Arf| HM:PFM:REP 154->192|PF01637|0.00017|21.1|38/234|Arch_ATPase| GO:PFM:NREP 2 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| RP:SCP:NREP 2 RP:SCP:REP 74->167|2p67A1|5e-04|22.0|91/301|c.37.1.10| RP:SCP:REP 154->246|1xzpA1|9e-09|13.3|83/173|a.24.25.1| HM:SCP:REP 68->288|1t9hA2|3.7e-32|30.7|205/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 295 OP:NHOMOORG 245 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---1--1-----11---1111111111111--- 11--11--2-2-112------------------------------------------------------------------------1---------------111-121111121211111112311-151-112-1-11-11-11-111-1211111---11111112311311222C222312313-431-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 347 STR:RPRED 93.0 SQ:SECSTR ##########################EEEcccccHHHHHHHcccccEETTEEccccTTcccEEcGGGcEEEEEEETTTccEEEEEEEEHHHTTTEEEEEEcTTccTHHHHHHHHHHcccGGGEEEccccccccHHHHHHHTTcccGGGccccHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccEEEEEcccHHcTTccccEEccEEEEEETTTTccHGGGGGGGHHHHHTTcHHHHHHHHHHGGGEEEEccccHcccEEEEEEccTHHHHTHHHHHHHHTTcccHHHHHHHHHHcccccTTcEEEEEcEEEEEEEEEEEccccEEEEETTTEEEEEccccEEEEEEETTccEEEEEccc DISOP:02AL 1-3| PSIPRED cccccccEEEEcccccEEEcccccccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHccccEEEEEEcHHcccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccccccEEEEcccccccccEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccEEEEccEEEEEEEccccEEEEEEEcccccEEcccHHHHHHHHHHHcccccccccHHHHHHccccEEEEEEcccccEEEEEccEEEEEcccEEEEEEEcccEEEEEEcccc //