[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99312.1
DDBJ      :             Conserved hypothetical protein, HD domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  235/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->197 2ogiB PDBj 2e-46 52.7 %
:RPS:PDB   32->199 3ccgA PDBj 8e-15 28.3 %
:RPS:SCOP  32->148 1u6zA1  a.211.1.5 * 8e-08 9.7 %
:HMM:SCOP  28->181 1xx7A_ a.211.1.1 * 1.1e-10 21.6 %
:HMM:PFM   32->144 PF01966 * HD 1.1e-17 30.0 100/118  
:BLT:SWISS 32->194 YQEK_BACSU 3e-37 44.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99312.1 GT:GENE ABD99312.1 GT:PRODUCT Conserved hypothetical protein, HD domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 551414..552013 GB:FROM 551414 GB:TO 552013 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein, HD domain GB:NOTE COG1713 [H] Predicted HD superfamily hydrolase involved in NAD metabolism GB:PROTEIN_ID ABD99312.1 GB:DB_XREF GI:90820673 LENGTH 199 SQ:AASEQ MNNLDLEYTEGIFPGTREELVKKVKESVKESRFKHILGVEKSAIELAKQNDYSTEKASIAALVHDYAKERTPEEFKKTILDENLSKDLLNWNNFIWHGVVGAEIIKNELQIKNEEILNAVRRHTVGDVEMTTLDKIIYVADYIEEGRSFPGVKLARTIAKTNLDDAVSYETKHVLEFLLSQDKVIYPKAILTYNKWVAE GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 32->194|YQEK_BACSU|3e-37|44.2|163/186| SEG 18->31|eelvkkvkesvkes| BL:PDB:NREP 1 BL:PDB:REP 32->197|2ogiB|2e-46|52.7|165/190| RP:PDB:NREP 1 RP:PDB:REP 32->199|3ccgA|8e-15|28.3|166/184| HM:PFM:NREP 1 HM:PFM:REP 32->144|PF01966|1.1e-17|30.0|100/118|HD| RP:SCP:NREP 1 RP:SCP:REP 32->148|1u6zA1|8e-08|9.7|113/197|a.211.1.5| HM:SCP:REP 28->181|1xx7A_|1.1e-10|21.6|134/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 237 OP:NHOMOORG 235 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------11111---------------------------------------------------------------111111111--------1111-----------------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1211-111111111-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--11--------1-1--111-111111111111--111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 84.4 SQ:SECSTR ###############################HHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHTTTTTTccHHHHHHHHHHTTccccHHHHTTTTcHcHHHHHHHHHHTTccccHHHHHHHHTTTTcccccHHHHHHHHHHHHcTTcccTTHHHHHHHHHHcHHHHHTHHHHHHHHHHHHHTccccHHHHHHHHHHHHH DISOP:02AL 1-3| PSIPRED ccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcc //