[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99313.1
DDBJ      :             Iojap-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  793/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->109 2o5aB PDBj 3e-25 49.0 %
:RPS:SCOP  2->114 2id1A1  d.218.1.12 * 6e-34 30.1 %
:RPS:PFM   6->104 PF02410 * DUF143 2e-22 51.5 %
:HMM:PFM   7->104 PF02410 * DUF143 5.6e-36 57.1 98/100  
:BLT:SWISS 1->112 YQEL_BACSU 9e-26 46.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99313.1 GT:GENE ABD99313.1 GT:PRODUCT Iojap-related protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 552036..552389 GB:FROM 552036 GB:TO 552389 GB:DIRECTION + GB:PRODUCT Iojap-related protein GB:NOTE COG0799 [S] Uncharacterized homolog of plant Iojap protein GB:PROTEIN_ID ABD99313.1 GB:DB_XREF GI:90820674 LENGTH 117 SQ:AASEQ MDSKKLLEIVVKAADSKRAEDTVALDVQEISILADYFVITQANSERQVKAIADAVKEQVYEAGADVKDIEGKDGANWILLDLGDVVVHVFKTETRQFYNLEKLWSDAPLVNIADWIK GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 1->112|YQEL_BACSU|9e-26|46.4|112/118| BL:PDB:NREP 1 BL:PDB:REP 3->109|2o5aB|3e-25|49.0|104/104| RP:PFM:NREP 1 RP:PFM:REP 6->104|PF02410|2e-22|51.5|99/99|DUF143| HM:PFM:NREP 1 HM:PFM:REP 7->104|PF02410|5.6e-36|57.1|98/100|DUF143| RP:SCP:NREP 1 RP:SCP:REP 2->114|2id1A1|6e-34|30.1|113/120|d.218.1.12| OP:NHOMO 860 OP:NHOMOORG 845 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111-1-111111111111111--111111-111111111111111111111111111-----11111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111------------11------1-11-11111111111111111111-11211111111-1111111111111111111111111-11111111111-11111111111111111111111111111111111-1111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-1111111111111111111111--11-11111-----------1-----11111111-111111111111111111111--11111------11--1-11111111-11-1121111111111111111111111111111111111111111111111111-11111111111111-11111111111111-1111111111111111111111111111111111111111111111111111111111111111111111--------11111-11111111--------1-1-------------------------1111111111111 ------------111-----------------------------------------------------------------------------------------11--1111----1-1111--11-1-141-1111-1-1-11------1-1--1111----1-1--1-2---12--171111-1112--1-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 91.5 SQ:SECSTR ##cHHHHHHHHHHHHHTTcEEEEEEETGGTTTcccEEEEEEEccHHHHHHHHHHHHHHHHHTTccccEEEcTTTTcEEEEEcccEEEEEEETTccTTTcTTTcccEEcc######## DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHcccccEEEEEcccccEEccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEcccHHHHHHHHHHHHHccccEEcHHHHcc //