[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99322.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   39->91 PF05176 * ATP-synt_10 0.00074 13.5 52/254  
:BLT:SWISS 29->106 RNC_CLOTE 5e-04 34.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99322.1 GT:GENE ABD99322.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 559288..559608 GB:FROM 559288 GB:TO 559608 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99322.1 GB:DB_XREF GI:90820683 LENGTH 106 SQ:AASEQ MLRKTKNFLKANGVYYEKEHVNPLMVPERVYVLKFGIDEKTMNNRFIVEYTYTWTGRIKINKISLRLHGQQHPREFRNEAQLLQYLKKHSKRYVKGKEISNKKRSK GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 29->106|RNC_CLOTE|5e-04|34.6|78/100| HM:PFM:NREP 1 HM:PFM:REP 39->91|PF05176|0.00074|13.5|52/254|ATP-synt_10| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---1111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,96-107| PSIPRED ccHHHHHHHHHHcccccHHHcccEEcccEEEEEEEcccccccccEEEEEEEEEEEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccccc //