[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99330.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->182 ACT29_DICDI 3e-04 27.9 %
:PROS 97->122|PS00217|SUGAR_TRANSPORT_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99330.1 GT:GENE ABD99330.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 566127..566771 GB:FROM 566127 GB:TO 566771 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99330.1 GB:DB_XREF GI:90820691 LENGTH 214 SQ:AASEQ MNNRDIAKKISEVYPLNWSELQSVLNKLFINRLEKNLINICFLSGLLQGDTDDEEILLEEFGLTMDAANWCSNFLYEFSKVMNSQERVNTVKENISLVGLEDGNILPKSIVIRVEDAEEELKIKDINCTVSFKESYDKEIGRINISGEIKHGYGKNRLLFLIAYNDKNEVIDWKAETKLSDKEGTEIFNSEMSFPIDEKLLGIYIRPALNPLGS GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 15->182|ACT29_DICDI|3e-04|27.9|154/100| PROS 97->122|PS00217|SUGAR_TRANSPORT_2|PDOC00190| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,213-215| PSIPRED ccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHcEEEEEEccccccccEEEEEEEccccEEEEEEEEEEEEEcHHccccccEEEEEEEEEccccccEEEEEEEEcccccEEEEccccccccccccHHHcccccccccccEEEEEEEcccccccc //