[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99331.1
DDBJ      :             Two-component response regulator
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  858/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->227 1ys6B PDBj 6e-33 45.8 %
:RPS:PDB   1->224 3c3wB PDBj 6e-23 16.5 %
:RPS:SCOP  3->103 1a0oA  c.23.1.1 * 6e-18 21.8 %
:RPS:SCOP  130->228 1gxpA  a.4.6.1 * 2e-23 34.3 %
:HMM:SCOP  1->193 1s8nA_ c.23.1.1 * 4.4e-38 30.4 %
:RPS:PFM   4->103 PF00072 * Response_reg 1e-10 35.0 %
:RPS:PFM   154->224 PF00486 * Trans_reg_C 4e-11 43.7 %
:HMM:PFM   4->112 PF00072 * Response_reg 2.3e-29 34.9 109/112  
:HMM:PFM   152->226 PF00486 * Trans_reg_C 1.3e-26 45.9 74/77  
:BLT:SWISS 1->227 ARLR_STAS1 3e-51 47.5 %
:PROS 88->113|PS00217|SUGAR_TRANSPORT_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99331.1 GT:GENE ABD99331.1 GT:PRODUCT Two-component response regulator GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 567551..568237 GB:FROM 567551 GB:TO 568237 GB:DIRECTION + GB:PRODUCT Two-component response regulator GB:NOTE COG0745 [TK] Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain GB:PROTEIN_ID ABD99331.1 GB:DB_XREF GI:90820692 LENGTH 228 SQ:AASEQ MSRILIIEDEKNLSRFVELELQHEEYETEVCKNGRQGLELALDEDWDAILLDLMLPELNGLDICRRVRQVKNTPIIMMTARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRAVLRRVELENEQNGNKQTTLTYRDLTIEKENRVVRRGDEIIELTKREYELLLTLMENINVVLARDTLLKKVWGYETQIETNVVDVYIRYLRNKIDRPGEDSYIQTVRGTGYVMRS GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 1->227|ARLR_STAS1|3e-51|47.5|219/220| PROS 88->113|PS00217|SUGAR_TRANSPORT_2|PDOC00190| SEG 18->29|elelqheeyete| SEG 106->122|eellarlravlrrvele| BL:PDB:NREP 1 BL:PDB:REP 33->227|1ys6B|6e-33|45.8|192/227| RP:PDB:NREP 1 RP:PDB:REP 1->224|3c3wB|6e-23|16.5|206/210| RP:PFM:NREP 2 RP:PFM:REP 4->103|PF00072|1e-10|35.0|100/111|Response_reg| RP:PFM:REP 154->224|PF00486|4e-11|43.7|71/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 4->112|PF00072|2.3e-29|34.9|109/112|Response_reg| HM:PFM:REP 152->226|PF00486|1.3e-26|45.9|74/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 3->103|1a0oA|6e-18|21.8|101/128|c.23.1.1| RP:SCP:REP 130->228|1gxpA|2e-23|34.3|99/103|a.4.6.1| HM:SCP:REP 1->193|1s8nA_|4.4e-38|30.4|184/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 10007 OP:NHOMOORG 884 OP:PATTERN -----------------------------1-----1--11--111-14-4111--------------- 8EJ7K466778545BAAAA-AF449BAAAAA7HDEE8EFD87CC99676887BCE35711IGJ6P7HPMO9333354457IB713366EEXM-A22---35G4A9L6I8J-------1--1111232222214242NNNOMG7EQ5eMVOMLAFC9B778A99LHDBZaiH583554574545EE577341A6GTTUTUSUUHVSXWUQEGDBBCUVb7ACW8EDA99A9AdW7AB9A99899AAA9979996B675CC655466677CC655675575DED866899988888898888555556666765598766476775SKLeQQQVUUVSSLEcUU9DFBPKG8BBGN84bWKCA435547686128D85DCC966656DALHIC9BCKCDJAA9AAAAA99C-EFFDFJFIBL91OIILHEGNNIFECL8B898DDACD9A8BBBBBBBB8A997HEA22222222222223333232233232222369F56AEDAGPQTRVNJHHHDNNOPIGIIBITOOKNMS12GKLLCGBAVFHGL5EIGA899861211111754BHV9FD963835GB446-JBFEBEDABB9CAGL7AC7654555555242223222AG69D66HG8CGDJ7FEBJDIIFAHGHGGHIHGHILM--34745------FDDEEFAFFFGFGGHEF-FHGEFFFEFGFFFFFFFFDIGHCF888EDDEEEEEDEECECEEHDBDDDEF81CEEEEEEEFEEE--2D3333334347DSBN434333244443115DCABD8B99AGBROSRNUUVIOQRQHKLO3212132126FFFOEEEEEGGIGHNOGCICDEED7767--G16666552--1-111312-------------------------47433454444E3 --------------2------------------------------------------------------------------------1------1-1-------------------------------------------------------------1----2---------3-11--------2--A---1-B---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHTHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTccccc DISOP:02AL 118-133| PSIPRED ccEEEEEcccHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHcccccccccccEEEEccEEEEcccEEEEEccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHccccccccEEEEEcccEEEEcc //