[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99340.1
DDBJ      :             Alkaline shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  195/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->120 PF03780 * DUF322 2e-17 43.8 %
:HMM:PFM   15->119 PF03780 * DUF322 1.3e-38 49.5 105/108  
:BLT:SWISS 1->119 YQHY_BACSU 6e-29 47.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99340.1 GT:GENE ABD99340.1 GT:PRODUCT Alkaline shock protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 575707..576129 GB:FROM 575707 GB:TO 576129 GB:DIRECTION + GB:PRODUCT Alkaline shock protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99340.1 GB:DB_XREF GI:90820701 LENGTH 140 SQ:AASEQ MADNIVLKNEETNDLGRIEMAPEVLEIIIGIAAAKVDGVYSMRGSLANNISALLGRQNRGKGVKLSNTDTDLAVDVYTFLNYGVSVPKVANEIQEKVRQQVLFMTGIELAAVNVHIQGMVPEKEEPTVDPNNLFEENGDE GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 1->119|YQHY_BACSU|6e-29|47.1|119/135| RP:PFM:NREP 1 RP:PFM:REP 16->120|PF03780|2e-17|43.8|105/107|DUF322| HM:PFM:NREP 1 HM:PFM:REP 15->119|PF03780|1.3e-38|49.5|105/108|DUF322| OP:NHOMO 379 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ------------1--------------------1111------------2--------------1-11-1--------1--1--------------------------------------------------------------1----------------------------------------1--21-31222222222222222222222222222221212222222313333333333333333323222133121212222442222222222222222222222222222222222222222222222222222223321222222222211222222111-121111221-2124111122-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,125-141| PSIPRED ccccccccccccccccEEEEcHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHccccccccEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEccccccccccHHHccccccc //