[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99353.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
a.204.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->95 2cjeA PDBj 7e-10 18.9 %
:RPS:SCOP  28->95 2a3qA1  a.204.1.2 * 3e-10 23.0 %
:HMM:SCOP  1->96 2a3qA1 a.204.1.2 * 2.7e-21 33.3 %
:RPS:PFM   25->91 PF03819 * MazG 2e-04 35.0 %
:HMM:PFM   22->95 PF03819 * MazG 3e-17 32.8 67/74  
:BLT:SWISS 21->94 VG37_BPML5 2e-08 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99353.1 GT:GENE ABD99353.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 585081..585380 GB:FROM 585081 GB:TO 585380 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:NOTE COG1694 [R] Predicted pyrophosphatase GB:PROTEIN_ID ABD99353.1 GB:DB_XREF GI:90820714 LENGTH 99 SQ:AASEQ MEFNEYQEAANRTLYGNEQVLTNCALGLAGETGQVVDLVKAYTFKGKDLDKEKLVHELGDVLWYLSQIAEWADIPFDEVAQENIETLNKRYPNGFNPAN GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 21->94|VG37_BPML5|2e-08|37.0|73/100| RP:PDB:NREP 1 RP:PDB:REP 1->95|2cjeA|7e-10|18.9|95/258| RP:PFM:NREP 1 RP:PFM:REP 25->91|PF03819|2e-04|35.0|60/67|MazG| HM:PFM:NREP 1 HM:PFM:REP 22->95|PF03819|3e-17|32.8|67/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 28->95|2a3qA1|3e-10|23.0|61/113|a.204.1.2| HM:SCP:REP 1->96|2a3qA1|2.7e-21|33.3|96/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 71 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1--------------------------------------------------------------------111------------------1----1----------11---1-11------------11111----12-1------------------111121-----1-1--1-------------1-11-1---111111111---111-------------------------------------------------1111111-1---------------1--------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111----------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----1-----------------11---------------------------------1-------------------------------------------------1----1--------1---------------------------------------------------- STR:NPRED 95 STR:RPRED 96.0 SQ:SECSTR HHHHHHHHHHHHHHcTTHccHHHHHHHHHHHHHHHHTTccccccccTTccHHHHHHHHHHHHHHHHHHHHHHHTccGGGccGGGTccGGGTcccc#### DISOP:02AL 1-1,93-100| PSIPRED ccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccc //