[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99361.1
DDBJ      :             Glucokinase
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  432/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->320 2qm1B PDBj 3e-96 62.3 %
:RPS:PDB   6->316 3bp8A PDBj 4e-38 22.7 %
:RPS:SCOP  3->317 1sz2A1  c.55.1.7 * 5e-31 9.9 %
:HMM:SCOP  1->318 1sz2A1 c.55.1.7 * 3.1e-65 38.3 %
:RPS:PFM   7->192 PF00480 * ROK 2e-25 38.9 %
:HMM:PFM   7->191 PF00480 * ROK 9.5e-47 39.5 177/179  
:HMM:PFM   208->248 PF03622 * IBV_3B 0.00026 36.6 41/64  
:BLT:SWISS 7->315 GLK_BACSU 3e-52 45.2 %
:PROS 139->165|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99361.1 GT:GENE ABD99361.1 GT:PRODUCT Glucokinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 592926..593888 GB:FROM 592926 GB:TO 593888 GB:DIRECTION + GB:PRODUCT Glucokinase GB:NOTE COG1940 [KG] Transcriptional regulator/sugar kinase GB:PROTEIN_ID ABD99361.1 GB:DB_XREF GI:90820722 LENGTH 320 SQ:AASEQ MNKKLIGVDLGGTTIKFAILTLDGEIQQKWSVETNILDDGKHIVPDIVESINHHLDLYDMKPEQFVGIGMGTPGTVDIENGTVEAAFNLNWKEKQNLKEEIEKGTGMKFAVDNDANVAALGERWKGAGENDDEVTFVTLGTGVGGGVITNGEMVHGAGAGGEIGHINVQPNGYLCTCGNHGCLETYASATGVVRVARDMAEEFAGKSDLKKMLDDGQDISSKIVFDLAKDGDVLAERVVDRVCYYLGFACANIGSLINPSYIVIGGGVSAAGKFLLDQVDSYFKEFAFPSVKKSTTLKLAELGNEAGVIGAASLALKFNK GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 7->315|GLK_BACSU|3e-52|45.2|301/321| PROS 139->165|PS01125|ROK|PDOC00866| SEG 134->151|vtfvtlgtgvgggvitng| SEG 155->166|hgagaggeighi| BL:PDB:NREP 1 BL:PDB:REP 2->320|2qm1B|3e-96|62.3|316/321| RP:PDB:NREP 1 RP:PDB:REP 6->316|3bp8A|4e-38|22.7|300/381| RP:PFM:NREP 1 RP:PFM:REP 7->192|PF00480|2e-25|38.9|180/181|ROK| HM:PFM:NREP 2 HM:PFM:REP 7->191|PF00480|9.5e-47|39.5|177/179|ROK| HM:PFM:REP 208->248|PF03622|0.00026|36.6|41/64|IBV_3B| RP:SCP:NREP 1 RP:SCP:REP 3->317|1sz2A1|5e-31|9.9|293/319|c.55.1.7| HM:SCP:REP 1->318|1sz2A1|3.1e-65|38.3|290/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 830 OP:NHOMOORG 484 OP:PATTERN ----------------11------1---111------------------------------111---- 142-4111111111------------------1---1134111223113-112441-2111-211-3353211113121--11-11113242-5-1---11----1-214--------------11-111111121-112211122-111111-----1---11111222-------------2-1--33-212111111322121112142221111123-4215445434411111111111111111111221111111--2111111121111232222233111222122211222222122112212211111211121-262222221222231113232121-111-1----113-1264421211121--------1------------------------------------3--111-112---------------1---------------------------------------------------------------------------------------------------------1----------------------------------112---111111--1---------------------------112----------------------------------------32312222222222222-222222222222222222223222211343333333333333332222222--222222212222----------------------1---------1-----------------------------2--21211--33323333322222-----------------1--111111-11----------1-------------1------1331112222--1 --------------------------------------------------------------------------------------------------------------3-11121111--1132111381-114--11111111-11-11-1-1111-----------------------------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 320 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEcccEEEEEEEETTccEEEEEEEEcccccccccHHHHHHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEcccccccccccTTTHHHHTTcccEEEEEHHHHHHHHHHHccTTTTcccEEEEEEcccEEEEEEETTEEccccccccccGGGcccccccccccccccccTTTccHHHHHHHHHTccTGGTTccGTTTTccccccccHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHHTTccEEEccccTTcGGGGHHHHHHTGcc DISOP:02AL 1-1| PSIPRED cccEEEEEEEcccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccEEEEcccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHHccccccccEEEEEEEccccccEEEccEEEEccccccccccEEEcccccccccccccEEEEEcccHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHccHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHcc //