[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99362.1
DDBJ      :             Conserved hypothetical protein, rhodanese-like domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  144/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.46.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->128 2kl3A PDBj 3e-08 35.1 %
:RPS:PDB   51->136 2eg3B PDBj 6e-16 25.6 %
:RPS:SCOP  55->128 1yt8A2  c.46.1.2 * 4e-15 35.1 %
:HMM:SCOP  8->128 1c25A_ c.46.1.1 * 3.9e-23 29.2 %
:RPS:PFM   55->128 PF00581 * Rhodanese 3e-06 33.8 %
:HMM:PFM   43->129 PF00581 * Rhodanese 2e-18 29.9 87/113  
:HMM:PFM   7->36 PF05975 * EcsB 0.00016 30.0 30/386  
:BLT:SWISS 13->121 YQHL_BACSU 1e-20 42.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99362.1 GT:GENE ABD99362.1 GT:PRODUCT Conserved hypothetical protein, rhodanese-like domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 593931..594344 GB:FROM 593931 GB:TO 594344 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein, rhodanese-like domain GB:NOTE COG0607 [P] Rhodanese-related sulfurtransferase GB:PROTEIN_ID ABD99362.1 GB:DB_XREF GI:90820723 LENGTH 137 SQ:AASEQ MFLADISVWAWVNIILILLVAYLLGMQLYTYISGKRVSTMLDNEEFKKGMKKAQVIDLREPDTFNAGHILGARNMPYSQFKIYKSSLRKDMPVYLYETGRTIATRAAVQLYKDGFRDLYILKSGYDRWDGKKKKSKY GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 13->121|YQHL_BACSU|1e-20|42.2|109/126| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 55->128|2kl3A|3e-08|35.1|74/132| RP:PDB:NREP 1 RP:PDB:REP 51->136|2eg3B|6e-16|25.6|86/226| RP:PFM:NREP 1 RP:PFM:REP 55->128|PF00581|3e-06|33.8|74/108|Rhodanese| HM:PFM:NREP 2 HM:PFM:REP 43->129|PF00581|2e-18|29.9|87/113|Rhodanese| HM:PFM:REP 7->36|PF05975|0.00016|30.0|30/386|EcsB| RP:SCP:NREP 1 RP:SCP:REP 55->128|1yt8A2|4e-15|35.1|74/101|c.46.1.2| HM:SCP:REP 8->128|1c25A_|3.9e-23|29.2|120/0|c.46.1.1|1/1|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 146 OP:NHOMOORG 145 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111112111111--111111111111111111111111111111111111111111-1111111111111111111111111111111111111111---1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 81.0 SQ:SECSTR #########################cTTccEEcHHHHHHHHTcTTTTTTETTcEEEEcccHHHHHHcccTTcEEccccccccHHHHTTccccEEEEcccccHHHHHHHHHHHHTTccEEEEccccGGGcccccccc# DISOP:02AL 133-138| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHccccEEEEcccHHHHHcccccccccccHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHcccc //