[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99369.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->113 PF06115 * DUF956 3e-37 67.3 %
:HMM:PFM   1->118 PF06115 * DUF956 5.3e-61 63.6 118/118  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99369.1 GT:GENE ABD99369.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 599740..600117 GB:FROM 599740 GB:TO 600117 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99369.1 GB:DB_XREF GI:90820730 LENGTH 125 SQ:AASEQ MVQSINTKVDLTMAGTSYMGLSDYGKIMIGDKGFEFFNDRDVRKYIQIPWEEVDVVIASVMFKGKWIPRFALRTKKNGMFTFSAKNSKEVLRAIREYVPADRMVRSLTFFQVIKRNLKNLFKNKK GT:EXON 1|1-125:0| SEG 114->124|krnlknlfknk| RP:PFM:NREP 1 RP:PFM:REP 1->113|PF06115|3e-37|67.3|113/117|DUF956| HM:PFM:NREP 1 HM:PFM:REP 1->118|PF06115|5.3e-61|63.6|118/118|DUF956| OP:NHOMO 95 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1--111111----------------------11-1111111111--1112111121111111111111111111111111111111111111111111111---11111-1--111-----111---1----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,122-126| PSIPRED cccccccEEEEEEEEEEEEccccccEEEEEccEEEccccccHHHEEEEcHHHEEEEEEEEEEccEEEEEEEEEEEcccEEEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccc //