[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99374.1
DDBJ      :             Membrane endopeptidase, M50 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  672/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.36.1
:425 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->234 1xiyA PDBj 7e-04 27.5 %
:BLT:PDB   210->289 3id2A PDBj 2e-05 28.8 %
:RPS:PDB   207->250 3cs0A PDBj 1e-08 18.2 %
:RPS:SCOP  207->247 1sotA1  b.36.1.4 * 4e-07 34.1 %
:HMM:SCOP  160->271 1uewA_ b.36.1.1 * 3.4e-16 20.9 %
:RPS:PFM   13->76 PF02163 * Peptidase_M50 5e-18 54.7 %
:RPS:PFM   150->415 PF02163 * Peptidase_M50 1e-29 32.1 %
:HMM:PFM   7->418 PF02163 * Peptidase_M50 2.7e-75 49.0 192/193  
:BLT:SWISS 11->423 EEP_ENTFA e-121 53.9 %
:PROS 16->25|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99374.1 GT:GENE ABD99374.1 GT:PRODUCT Membrane endopeptidase, M50 family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 603251..604528 GB:FROM 603251 GB:TO 604528 GB:DIRECTION + GB:PRODUCT Membrane endopeptidase, M50 family GB:NOTE COG0750 [M] Predicted membrane-associated Zn-dependent proteases 1 GB:PROTEIN_ID ABD99374.1 GB:DB_XREF GI:90820735 LENGTH 425 SQ:AASEQ MIITIIAFIIVFGVLVFVHEFGHYFFAKKAGILVREFSIGMGPKLWFYRKNSTTYTIRLLPIGGYVRMAGAEEDDVPLKKGMTVSLLINDENKVVKINTSNKKTLISGVPVQISDWDLEDKLWIEGYENGNDSELKVYEVDHDACIIENDGTEVQIAPKDVQFQSAKIIQRMLTNFAGPMNNFILAIVAFLVIALVQGGVASTDNQIGKVQENSVAQKAGIKPNDRIIAVDNIKTTTWQEASAQIQKNGNKKIILKIDRKNKIIKIKITPKVQIENGKKVGMIGVMAKVHYDKSIVAILSYGFTQTWYIITSIIGVLGKMFTQGFSLNDLGGPVAMYSYTSEAAHYGILSVMNLMAVLSINLGIVNLLPIPALDGGKLLLNIVEAIRRKPLDPEKEGIITLVGFGFLMILMILVTWNDIQRYFLH GT:EXON 1|1-425:0| BL:SWS:NREP 1 BL:SWS:REP 11->423|EEP_ENTFA|e-121|53.9|410/422| PROS 16->25|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 4 TM:REGION 1->23| TM:REGION 289->311| TM:REGION 354->376| TM:REGION 399->421| SEG 2->10|iitiiafii| SEG 251->274|kkiilkidrknkiikikitpkvqi| BL:PDB:NREP 2 BL:PDB:REP 72->234|1xiyA|7e-04|27.5|153/171| BL:PDB:REP 210->289|3id2A|2e-05|28.8|80/90| RP:PDB:NREP 1 RP:PDB:REP 207->250|3cs0A|1e-08|18.2|44/379| RP:PFM:NREP 2 RP:PFM:REP 13->76|PF02163|5e-18|54.7|64/331|Peptidase_M50| RP:PFM:REP 150->415|PF02163|1e-29|32.1|262/331|Peptidase_M50| HM:PFM:NREP 1 HM:PFM:REP 7->418|PF02163|2.7e-75|49.0|192/193|Peptidase_M50| GO:PFM:NREP 4 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| RP:SCP:NREP 1 RP:SCP:REP 207->247|1sotA1|4e-07|34.1|41/78|b.36.1.4| HM:SCP:REP 160->271|1uewA_|3.4e-16|20.9|110/0|b.36.1.1|1/1|PDZ domain-like| OP:NHOMO 694 OP:NHOMOORG 679 OP:PATTERN -------------------------------------------------------------------- 111-1--------------------------------1--------------------11---1-----1--------11---11111------------------1-1-1111111--------1-1122111111-------1111-----11---------111-1-1--1---------1111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111112111111111111111111111111111-1111111-1111111111111111111111111111---1-11-1-11111111111111111---1111---11-1111111111111-11111111111111--11---------1-1-1111111111111111111111111111111111111111111111---1111111111111111111111111111111111--11111111111111122222111111111----1111-------11111111111111111111111111111111111111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111-11121--22221111111111111111111111111111111111111111111111111---------111111111111111-11111111111111-1---1111--------1-1-------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111--1-----11------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 50.4 SQ:SECSTR #######################################################################TTccccccEEE#EEHHHHTcccEEEEEHTTcEEEEEEcccTTcHHHHT###HHHHHHHTHHHHHTTccccEEEEEEcccHHHHHHHHHHTTccccEEEEcTTcHHHHHTTGGTccEEEccEEEEEEEcTTcccEEEcccccccTTGGGTccTTcEEccccccccccHHHHHHHHHTcccccEEEEEEETTEEEEEEEccEEEcTTTTcEEEccEEccc######################################################################################################################################## DISOP:02AL 73-81| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccEEEEEEcccEEEEEEEEEEccEEEcccccccccccccccEEEEEEcccccEEEEEccccccccccEEEEEEEccccccEEEEEcccccEEEEEEEEEccEEEEEEcccccccHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEcccccEEEEEEEEEEEEccccEEEEEEEEEccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //