[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99392.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->63 PF09984 * DUF2222 1.7e-05 18.3 60/146  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99392.1 GT:GENE ABD99392.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(627569..627898) GB:FROM 627569 GB:TO 627898 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99392.1 GB:DB_XREF GI:90820753 LENGTH 109 SQ:AASEQ MASNSDSLFFILSYIKRHPDDLVKAIPAYDNVIRLFISDKVKVSDAEIYFPDNSLMVNRLKLDFISQHGKLLDDFFQMTGRQLRGYHEVWASTAHLTDRNVYLVELSYE GT:EXON 1|1-109:0| HM:PFM:NREP 1 HM:PFM:REP 4->63|PF09984|1.7e-05|18.3|60/146|DUF2222| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---1111--111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccHHEEEEEHHccccHHEEEEccccccEEEEEccccEEccccEEEccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEEEcc //