[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99396.1
DDBJ      :             Cobyric acid synthase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  207/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->217 2abwA PDBj 5e-10 10.3 %
:RPS:SCOP  22->215 1gpwB  c.23.16.1 * 4e-10 15.3 %
:HMM:SCOP  14->194 1jvnA2 c.23.16.1 * 3.1e-22 18.5 %
:RPS:PFM   55->195 PF07685 * GATase_3 6e-08 25.7 %
:HMM:PFM   49->201 PF07685 * GATase_3 1.4e-37 32.9 146/158  
:HMM:PFM   19->66 PF07115 * DUF1371 7.4e-05 29.8 47/110  
:BLT:SWISS 113->195 COBQ_METST 3e-06 36.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99396.1 GT:GENE ABD99396.1 GT:PRODUCT Cobyric acid synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(630745..631449) GB:FROM 630745 GB:TO 631449 GB:DIRECTION - GB:PRODUCT Cobyric acid synthase GB:NOTE COG0121 [R] Predicted glutamine amidotransferase GB:PROTEIN_ID ABD99396.1 GB:DB_XREF GI:90820757 LENGTH 234 SQ:AASEQ MKYSLNLAHLYGDLLNTYGDIGNILALRYYAKQMDTNLKVDIISLNQEFNPEKYDIAFFGGGQDYEQMIVSKDIQSKKEALTKYIHDGGPMLAICGGYQLLGQYYIGADGQKIEGIHALDHYTESQDNNRFIGDIVIKNEETNQEYHGFENHNGVTYLGKNERPLGTVVSGHGNNGKDKTEGAIFKNTYCSYFHGPILARNGELAKRILITALQRKYPDADLSKQQALEIKPTY GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 113->195|COBQ_METST|3e-06|36.6|82/502| SEG 96->105|ggyqllgqyy| RP:PDB:NREP 1 RP:PDB:REP 23->217|2abwA|5e-10|10.3|194/216| RP:PFM:NREP 1 RP:PFM:REP 55->195|PF07685|6e-08|25.7|136/151|GATase_3| HM:PFM:NREP 2 HM:PFM:REP 49->201|PF07685|1.4e-37|32.9|146/158|GATase_3| HM:PFM:REP 19->66|PF07115|7.4e-05|29.8|47/110|DUF1371| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 1 RP:SCP:REP 22->215|1gpwB|4e-10|15.3|189/200|c.23.16.1| HM:SCP:REP 14->194|1jvnA2|3.1e-22|18.5|173/232|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 210 OP:NHOMOORG 210 OP:PATTERN --------------------------------11---------------------------------- ---1-11111111-11111-111111111111111111111--1-------11111----11-11-111111111111--1-1-----------------------------------------------------11111---11-11-111----------11--111------------------11-1-----------------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111-111111-111-1--11111111--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 91.9 SQ:SECSTR cccEEEEEccTTE##EEHHHHHEEEEEcTTcccHHccTTEEEEEEccHHHHHTccEEEEccccHHHHHTTHHHHHHHHHHHHHHHTccccEEEETHHHHHTEEEEEccccccTTGGGcccccEEEEEEcccccEEEEEcEEccTTcEEEEEcccEEEEEccTTcEEEEEEEETTTEEEEEEEEEETTEEEEccccGGGccccHHHHHHHHHHHHHHH################# DISOP:02AL 1-1,233-235| PSIPRED ccEEEEEEEEEccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEcccccHHHHHHHHHHHcccHHHHHHHHcccEEEEEEcccEEHHEEEEcccccEEccccEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEEEEEcccccccEEEEEEccccccccccccEEEccEEEEEcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHccccc //